DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and Wwp1

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:XP_006237992.1 Gene:Wwp1 / 297930 RGDID:1311734 Length:968 Species:Rattus norvegicus


Alignment Length:340 Identity:77/340 - (22%)
Similarity:117/340 - (34%) Gaps:106/340 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 DNVDDGGDAGEMAAASQTLSSAGTDVVGNGSGHGNGTVTG--------NGEKSGGLAPPGGHHLR 172
            |.|.:.||  .:...:..|:..||  :|..:.....||..        |||.:....|...  .|
  Rat   215 DAVHENGD--PLTRTTPRLAVEGT--IGIDNHVSTSTVVPSSCCSHIVNGENTPSSPPQVA--TR 273

  Fly   173 PPPPPALK-------------------KSASAVIGNSASREDVASLSGTSSLNSQ---------M 209
            |...||.|                   ..:::.:|.|...||..|.|..:|...|         .
  Rat   274 PQNTPAPKPLTSEPTSDTVNGESSSVLADSTSAMGTSLPSEDSTSTSNCTSTTVQEPPVQEPPAS 338

  Fly   210 SVHNQFISGLPSNGIGSNGVHGGAATGRGGPPNSILKGSKENLLQNTYY---------------- 258
            |.|::.|   ||            |:...||....|.....:...|:.:                
  Rat   339 SEHSECI---PS------------ASAEVGPEARSLIDPDSDSRNNSGFDKVRQPEGCVEPLRPQ 388

  Fly   259 NGETGDSSLGS-----ECGVGDVQHQNHESHDDPGDGLGPLPPKWETAYTERGELYFIDHNTGTS 318
            :|.|...||.|     :...|...:.:|.:.....:...||||.||....:||.:|::||||.|:
  Rat   389 SGNTNTESLPSGWEQRKDPHGRTYYVDHNTRTTTWERPQPLPPGWERRVDDRGRVYYVDHNTRTT 453

  Fly   319 HWLDPRLS--------KYQKKSLEDCCED--------------------ELPYGWEKIEDSMYGM 355
            .|..|.:.        :.|:..|:...:.                    .||.||||..||...:
  Rat   454 TWQRPTMESVRNFEQWQSQRNQLQGAMQQFNQRYLYSASMLAAENDPYGPLPPGWEKRVDSTDRV 518

  Fly   356 YFIDHVNRRTQYENP 370
            ||::|..:.||:|:|
  Rat   519 YFVNHNTKTTQWEDP 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809 14/28 (50%)
WW 342..372 CDD:238122 14/29 (48%)
PDZ 443..534 CDD:214570
DegQ <455..534 CDD:223343
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
Wwp1XP_006237992.1 C2_E3_ubiquitin_ligase 67..190 CDD:175988
PARM 243..>400 CDD:293666 33/173 (19%)
WW 397..426 CDD:278809 4/28 (14%)
WW 429..458 CDD:278809 14/28 (50%)
WW 504..533 CDD:278809 14/28 (50%)
WW 545..574 CDD:238122
HECTc 614..966 CDD:238033
HECTc 637..965 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.