DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and Bag3

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:NP_001011936.1 Gene:Bag3 / 293524 RGDID:1307794 Length:574 Species:Rattus norvegicus


Alignment Length:174 Identity:44/174 - (25%)
Similarity:62/174 - (35%) Gaps:46/174 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 GDGLG---PLPPKWETAY-TERGELYFIDHNTGTSHWLDPRLSKYQKKSLEDCCEDE-------L 341
            |:|..   ||||.||... .:.|..:|:|||:.|:.|.|||:.....|.........       |
  Rat    15 GNGASDRDPLPPGWEIKIDPQTGWPFFVDHNSRTTTWNDPRVPPEGPKETASSANGPSRDGSRLL 79

  Fly   342 P----------------------YGWEKIEDSMYGMYFIDHVNR-RTQYENPVLEAKRRAAEQSQ 383
            |                      .|.|..:..::..|....|.| ||       ||...|.::||
  Rat    80 PAREGHPIYPQLRPGYIPIPVHHEGSENRQPHLFHAYSQPGVQRFRT-------EAAAAAPQRSQ 137

  Fly   384 QQ-QQMQQQQQQMQEQRSKTPTALSETMPTEAAEAHEQEEDESP 426
            .. :....:..|..:|..:.|.|.:...||    ||..|..:||
  Rat   138 SPLRGGVTETTQTDKQCGQVPAAATAQPPT----AHGPERSQSP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809 12/29 (41%)
WW 342..372 CDD:238122 8/52 (15%)
PDZ 443..534 CDD:214570
DegQ <455..534 CDD:223343
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
Bag3NP_001011936.1 WW 23..55 CDD:197736 14/31 (45%)
BAG 423..500 CDD:214591
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.