DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and Nedd4l

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:XP_038952600.1 Gene:Nedd4l / 291553 RGDID:735047 Length:1259 Species:Rattus norvegicus


Alignment Length:636 Identity:136/636 - (21%)
Similarity:213/636 - (33%) Gaps:191/636 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QQQQQQQQQQQH----FNSNHFYQQQQ----PQQLAP--------LNASHQHQHSHPHPHPH-PV 84
            ::..:|:...:|    .:||....|.|    |..|.|        |..::...|::.....| |.
  Rat   426 EENSEQRDDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRSTQWHRPS 490

  Fly    85 AAATSFATFNGNSNLNSSLANGSSRKFNCSRDNVDD--------GGDAGE----------MAAAS 131
            ....|..:.|....:|...|:   |:|...|...:|        ||:..|          ||..|
  Rat   491 LMDVSSESDNNIRQINQEAAH---RRFRSRRHISEDLEPEASEGGGEGPEPWETISEEVNMAGDS 552

  Fly   132 QTLS-----------SAGTDVVGNGSGHGNGTVTGNGEKSGGL--APPGGH-------------- 169
            .:|:           ::..::....|.....|...|||:...|  ..|...              
  Rat   553 LSLALPPPPASPVSRTSPQELSEELSRRLQITPDSNGEQFSALIQREPSSRLRSCSVTDTVAEQA 617

  Fly   170 HLRPPPPPALKKSASAVIGNSASREDVASLSGTSSL-------------------NSQMSVHNQF 215
            ||.||..|..:..:|.|.|...|...||.:..|..|                   |::.:...:.
  Rat   618 HLPPPSTPTRRARSSTVTGGEESTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRP 682

  Fly   216 ISGLPSNGIGSNGVHGGAATGRGG--------PPNSI----------LKGSKEN----LLQNTYY 258
            |..|..:|.      .|:||....        .|.|:          |:|:|::    .:::|..
  Rat   683 IMQLAEDGA------SGSATNSNNHLVEPQIRRPRSLSSPTVTLSAPLEGAKDSPIRRAVKDTLS 741

  Fly   259 NGETGDSSLGSECGVGDVQHQNHESHDDPGDGLGPLPPKWETAYTERGELYFIDHNTGTSHWLDP 323
            |.:   |...|.......||:..:|.         |||.||......|..:||||||.|:.|.||
  Rat   742 NPQ---SPQPSPYNSPKPQHKVTQSF---------LPPGWEMRIAPNGRPFFIDHNTKTTTWEDP 794

  Fly   324 RLSKY-----QKKSLEDCCEDELPYGWEKIEDSMYGMYFIDHVNRRTQYEN------PVLEAKRR 377
            || |:     .|.||.......||.|||:........::|||.::....||      |:.::|  
  Rat   795 RL-KFPVHMRSKASLNPNDLGPLPPGWEERIHLDGRTFYIDHSSQVLCGENDTRESVPLYDSK-- 856

  Fly   378 AAEQSQQQQQMQQQQQQMQEQRSKTPTALSETMPTEAAEAHEQEED------ESPMKLPYKF--- 433
                          ..|.::.|.:.|......:|  .:...:|:.|      :.|..:|.:|   
  Rat   857 --------------ITQWEDPRLQNPAITGPAVP--YSREFKQKYDYFRKKLKKPADIPNRFEMK 905

  Fly   434 --TRNPAELQGQRINTT----LLK--------SSRGLGFTIVGSDGSAGGDVEE-FLQIKTVVPN 483
              ..|..|...:||.:.    :||        |.:||.:         ||...| |..:...:.|
  Rat   906 LHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDY---------GGVAREWFFLLSKEMFN 961

  Fly   484 GPAWLDGQLQTGDVLVYVNDTCVLGYTHHDMVNIFQSILPGERAALEVCRG 534
            ....|.....|.:..:.:|...  |..:.|.::.|..|  |..|.|.|..|
  Rat   962 PYYGLFEYSATDNYTLQINPNS--GLCNEDHLSYFTFI--GRVAGLAVFHG 1008

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809 14/28 (50%)
WW 342..372 CDD:238122 10/35 (29%)
PDZ 443..534 CDD:214570 23/103 (22%)
DegQ <455..534 CDD:223343 18/79 (23%)
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
Nedd4lXP_038952600.1 C2 <365..418 CDD:417471
WW 463..489 CDD:395320 3/25 (12%)
WW 653..682 CDD:395320 2/28 (7%)
WW 766..796 CDD:238122 15/29 (52%)
WW 815..865 CDD:197736 13/65 (20%)
HECTc 926..1255 CDD:214523 22/96 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.