DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and Y92H12A.2

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:NP_001293292.1 Gene:Y92H12A.2 / 171719 WormBaseID:WBGene00022358 Length:724 Species:Caenorhabditis elegans


Alignment Length:267 Identity:66/267 - (24%)
Similarity:103/267 - (38%) Gaps:63/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 EDVASLSGTSSLNSQ-----MSVH-----------------NQFISGLP------SNGIGSNG-- 228
            |:.|..|||:|....     :|.|                 .|..||:|      .:|   ||  
 Worm   122 EEYALQSGTASKGKSIGSLFLSFHFMPSSSDNSPSDSTADLQQTSSGMPQGWEEREDG---NGRT 183

  Fly   229 --VHGGAATGRGGPPNSILKGS----------------KENLLQNTYYNGETGDSSLGSE--CGV 273
              |:....|.:..||.|:..|:                ::|....:....|..|:::.|.  ..:
 Worm   184 VYVNHALRTTQFTPPESVSNGNVDAITEQSVIEETRRRRDNYEHRSQVTDEPSDTTIVSNELTAI 248

  Fly   274 GDVQHQNHE---SHDDPGDGLGPLPPKWETAYTERGELYFIDHNTGTSHWLDPRLSKYQK-KSLE 334
            .|....|.|   .|.:..:....||..|:......|..:||||.|.|:.|.|||.....: ..|.
 Worm   249 DDAMRANFERGGGHVEEEEDELRLPDGWDMQVAPNGRTFFIDHRTKTTTWTDPRPGAATRVPLLR 313

  Fly   335 DCCEDE---LPYGWEKIEDSMYGMYFIDHVNRRTQYENPVLEAKRRAAEQSQQQQQMQQQQQQMQ 396
            ...:||   ||.|||:...:...::||||..||||:|:|..|.:..|.......:..:::.:.: 
 Worm   314 GKTDDEIGALPAGWEQRVHADGRVFFIDHNRRRTQWEDPRFENENIAGPAVPYSRDYKRKVEYL- 377

  Fly   397 EQRSKTP 403
              ||:.|
 Worm   378 --RSRLP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809 11/28 (39%)
WW 342..372 CDD:238122 14/29 (48%)
PDZ 443..534 CDD:214570
DegQ <455..534 CDD:223343
PDZ_signaling 606..668 CDD:238492
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
Y92H12A.2NP_001293292.1 C2 20..147 CDD:301316 8/24 (33%)
WW 170..198 CDD:278809 6/30 (20%)
WW 272..301 CDD:278809 11/28 (39%)
WW 323..353 CDD:197736 14/29 (48%)
HECTc 393..721 CDD:238033
HECTc 415..720 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.