Sequence 1: | NP_001286661.1 | Gene: | Magi / 37403 | FlyBaseID: | FBgn0034590 | Length: | 1202 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001293292.1 | Gene: | Y92H12A.2 / 171719 | WormBaseID: | WBGene00022358 | Length: | 724 | Species: | Caenorhabditis elegans |
Alignment Length: | 267 | Identity: | 66/267 - (24%) |
---|---|---|---|
Similarity: | 103/267 - (38%) | Gaps: | 63/267 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 194 EDVASLSGTSSLNSQ-----MSVH-----------------NQFISGLP------SNGIGSNG-- 228
Fly 229 --VHGGAATGRGGPPNSILKGS----------------KENLLQNTYYNGETGDSSLGSE--CGV 273
Fly 274 GDVQHQNHE---SHDDPGDGLGPLPPKWETAYTERGELYFIDHNTGTSHWLDPRLSKYQK-KSLE 334
Fly 335 DCCEDE---LPYGWEKIEDSMYGMYFIDHVNRRTQYENPVLEAKRRAAEQSQQQQQMQQQQQQMQ 396
Fly 397 EQRSKTP 403 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Magi | NP_001286661.1 | WW | 294..323 | CDD:278809 | 11/28 (39%) |
WW | 342..372 | CDD:238122 | 14/29 (48%) | ||
PDZ | 443..534 | CDD:214570 | |||
DegQ | <455..534 | CDD:223343 | |||
PDZ_signaling | 606..668 | CDD:238492 | |||
PDZ | 925..1011 | CDD:214570 | |||
PDZ_signaling | 1029..1110 | CDD:238492 | |||
Y92H12A.2 | NP_001293292.1 | C2 | 20..147 | CDD:301316 | 8/24 (33%) |
WW | 170..198 | CDD:278809 | 6/30 (20%) | ||
WW | 272..301 | CDD:278809 | 11/28 (39%) | ||
WW | 323..353 | CDD:197736 | 14/29 (48%) | ||
HECTc | 393..721 | CDD:238033 | |||
HECTc | 415..720 | CDD:214523 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5021 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |