DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Magi and Gas7

DIOPT Version :9

Sequence 1:NP_001286661.1 Gene:Magi / 37403 FlyBaseID:FBgn0034590 Length:1202 Species:Drosophila melanogaster
Sequence 2:XP_006532265.1 Gene:Gas7 / 14457 MGIID:1202388 Length:476 Species:Mus musculus


Alignment Length:168 Identity:32/168 - (19%)
Similarity:58/168 - (34%) Gaps:34/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   647 GLNVRNKPHFYVVELLKECSQTTPTAVKIQRTPPDPPANNTLAQLNQVGNVAKLRKNFVGSGLFR 711
            |::....||       :....||........||..||....::.....|:...|..:..|....:
Mouse   113 GISASPGPH-------RSSLPTTVNGYHASGTPAHPPETAHMSLRKSTGDSQNLGSSSPGRKQSK 170

  Fly   712 SKTPTADLYSTQVKEVLPMRPKTPLVDTRRSRVQIQSPN----------NEVDDEGDGAAAAERK 766
            ..|.|.:..:....:.:|.:             |:..|.          ::.|.:|:|..|....
Mouse   171 ENTITINCVTFPHPDTMPEQ-------------QLLKPTEWSYCDYFWADKKDPQGNGTVAGFEL 222

  Fly   767 PLQLQTQGKS-NSSLQEL--DDIPYMDPYPK-ISRLSE 800
            .||.|.:||. ...:.|.  :.|...:.|.| :::||:
Mouse   223 LLQKQLKGKQMQKEMSEFIRERIKIEEEYAKNLAKLSQ 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagiNP_001286661.1 WW 294..323 CDD:278809
WW 342..372 CDD:238122
PDZ 443..534 CDD:214570
DegQ <455..534 CDD:223343
PDZ_signaling 606..668 CDD:238492 3/20 (15%)
PDZ 925..1011 CDD:214570
PDZ_signaling 1029..1110 CDD:238492
Gas7XP_006532265.1 SH3_GAS7 5..57 CDD:212763
WW_FCH_linker 109..201 CDD:374680 17/107 (16%)
F-BAR_GAS7 214..446 CDD:153333 13/47 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.