DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mago and MAGO

DIOPT Version :9

Sequence 1:NP_476636.1 Gene:mago / 37402 FlyBaseID:FBgn0002736 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_171716.1 Gene:MAGO / 837560 AraportID:AT1G02140 Length:150 Species:Arabidopsis thaliana


Alignment Length:143 Identity:113/143 - (79%)
Similarity:126/143 - (88%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSE 69
            :|||||||||||||||||||||||.||||||||||||||||:||||.|:..:|::|.|||:.:||
plant     8 EFYLRYYVGHKGKFGHEFLEFEFREDGKLRYANNSNYKNDTIIRKEVFLTPAVLKECKRIVSESE 72

  Fly    70 IMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLV 134
            |::|||..||.|||||:||||||:|:|||||.|||.|||||...|.||||||.||||||||||||
plant    73 ILKEDDNNWPEPDRVGKQELEIVLGNEHISFATSKIGSLVDCQSSNDPEGLRIFYYLVQDLKCLV 137

  Fly   135 FSLIGLHFKIKPI 147
            ||||.||||||||
plant   138 FSLISLHFKIKPI 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
magoNP_476636.1 Mago_nashi 5..147 CDD:199917 111/141 (79%)
MAGONP_171716.1 Mago_nashi 8..150 CDD:199917 111/141 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 237 1.000 Domainoid score I607
eggNOG 1 0.900 - - E1_KOG3392
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56794
Inparanoid 1 1.050 238 1.000 Inparanoid score I1092
OMA 1 1.010 - - QHG53852
OrthoDB 1 1.010 - - D1373136at2759
OrthoFinder 1 1.000 - - FOG0003788
OrthoInspector 1 1.000 - - oto3326
orthoMCL 1 0.900 - - OOG6_102299
Panther 1 1.100 - - LDO PTHR12638
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2645
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.