DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mago and MAGOHB

DIOPT Version :9

Sequence 1:NP_476636.1 Gene:mago / 37402 FlyBaseID:FBgn0002736 Length:147 Species:Drosophila melanogaster
Sequence 2:NP_060518.1 Gene:MAGOHB / 55110 HGNCID:25504 Length:148 Species:Homo sapiens


Alignment Length:143 Identity:131/143 - (91%)
Similarity:136/143 - (95%) Gaps:0/143 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEAFVHQSVMEELKRIIIDSE 69
            ||||||||||||||||||||||||||||||||||||||||.||||||:||:||||||||||.|||
Human     6 DFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSE 70

  Fly    70 IMQEDDLPWPPPDRVGRQELEIVIGDEHISFTTSKTGSLVDVNRSKDPEGLRCFYYLVQDLKCLV 134
            |.:|||..|||||||||||||||||||||||||||.|||:|||:||||||||.||||||||||||
Human    71 ITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLV 135

  Fly   135 FSLIGLHFKIKPI 147
            |||||||||||||
Human   136 FSLIGLHFKIKPI 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
magoNP_476636.1 Mago_nashi 5..147 CDD:199917 129/141 (91%)
MAGOHBNP_060518.1 Mago_nashi 6..148 CDD:199917 129/141 (91%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146198
Domainoid 1 1.000 272 1.000 Domainoid score I1813
eggNOG 1 0.900 - - E1_KOG3392
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56794
Inparanoid 1 1.050 274 1.000 Inparanoid score I2989
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53852
OrthoDB 1 1.010 - - D1373136at2759
OrthoFinder 1 1.000 - - FOG0003788
OrthoInspector 1 1.000 - - otm41474
orthoMCL 1 0.900 - - OOG6_102299
Panther 1 1.100 - - LDO PTHR12638
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R714
SonicParanoid 1 1.000 - - X2645
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.