DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and CYC8

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_009670.3 Gene:CYC8 / 852410 SGDID:S000000316 Length:966 Species:Saccharomyces cerevisiae


Alignment Length:424 Identity:84/424 - (19%)
Similarity:159/424 - (37%) Gaps:85/424 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 EQLQRRGSLSWQRFSQAALAILLLTHALKTHQRNLD---------WRTEYSL------------- 502
            :|.|::.....|:..|||:.           |:.||         |.:..||             
Yeast    15 QQQQQQQQQQQQQQQQAAVP-----------QQPLDPLTQSTAETWLSIASLAETLGDGDRAAMA 68

  Fly   503 FMSGVHVNQRNAKLYNNVGHALENEGKFEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEA 567
            :.:.:..|..:||...::.|...:...|:.|...:::|:.:..:.......:|..:..|.....|
Yeast    69 YDATLQFNPSSAKALTSLAHLYRSRDMFQRAAELYERALLVNPELSDVWATLGHCYLMLDDLQRA 133

  Fly   568 EQAYVQAKALFPQAKPGVS--YHARIAPNHLNVFINLANLIAKNQTRLEEADHLYRQAISMRSDY 630
            ..||.|  ||:..:.|.|.  :|.             ..::......|:.|:..:.:.:.:...:
Yeast   134 YNAYQQ--ALYHLSNPNVPKLWHG-------------IGILYDRYGSLDYAEEAFAKVLELDPHF 183

  Fly   631 VQA---YINRGDILMKLNRTAQAQEVYEQALLYDN---ENADIYYNLGVVFLEQGKSQQAQVYFN 689
            .:|   |...|.|.....:.:||.|.:...|....   :..||::.||.|....|:.|.|:..:.
Yeast   184 EKANEIYFRLGIIYKHQGKWSQALECFRYILPQPPAPLQEWDIWFQLGSVLESMGEWQGAKEAYE 248

  Fly   690 KAIELYPEHEQALLNSAILLQELG---GEEARRVSRSRLY----------KVLENDDQNEKVYFN 741
            ..:.....|       |.:||:||   |     :|..:.|          |.||.|..:...:::
Yeast   249 HVLAQNQHH-------AKVLQQLGCLYG-----MSNVQFYDPQKALDYLLKSLEADPSDATTWYH 301

  Fly   742 LGMLAMDESSFDEAEQFFKRAIHLKADFRSALF--NLALLLADTKRPLDAVPFLNQLIRHHPSHV 804
            ||.:.|..:.:..|...|::|::  .|.|:.:|  ::.:|.....:..||:....:.||.:|...
Yeast   302 LGRVHMIRTDYTAAYDAFQQAVN--RDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYIS 364

  Fly   805 KGLILLGDIYINHMKDLDEAEKCYRSILHYDPHN 838
            :....||.:|......|.:|...|:.....|.:|
Yeast   365 EVWYDLGTLYETCNNQLSDALDAYKQAARLDVNN 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 71/349 (20%)
TPR repeat 514..542 CDD:276809 6/27 (22%)
TPR repeat 547..591 CDD:276809 11/45 (24%)
TPR repeat 598..625 CDD:276809 2/26 (8%)
TPR repeat 630..660 CDD:276809 8/32 (25%)
TPR repeat 665..693 CDD:276809 8/27 (30%)
TPR repeat 737..764 CDD:276809 6/26 (23%)
TPR repeat 803..834 CDD:276809 6/30 (20%)
TPR repeat 839..867 CDD:276809 84/424 (20%)
CYC8NP_009670.3 TPR <38..142 CDD:223533 19/105 (18%)
TPR repeat 46..74 CDD:276809 3/27 (11%)
TPR repeat 80..108 CDD:276809 6/27 (22%)
TPR 94..391 CDD:223533 66/325 (20%)
TPR repeat 113..143 CDD:276809 8/31 (26%)
TPR repeat 150..178 CDD:276809 3/40 (8%)
TPR repeat 184..211 CDD:276809 7/26 (27%)
TPR repeat 223..253 CDD:276809 8/29 (28%)
TPR repeat 258..290 CDD:276809 9/36 (25%)
TPR repeat 296..324 CDD:276809 6/27 (22%)
TPR repeat 329..359 CDD:276809 5/29 (17%)
TPR repeat 364..393 CDD:276809 6/28 (21%)
Herpes_BLLF1 <697..944 CDD:282904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.