DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and TTL2

DIOPT Version :10

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_001319556.1 Gene:TTL2 / 820724 AraportID:AT3G14950 Length:730 Species:Arabidopsis thaliana


Alignment Length:276 Identity:61/276 - (22%)
Similarity:100/276 - (36%) Gaps:91/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   474 SQAALAILLLTHALK---------------THQRNLDWRTE-YSLFMSGVHVNQRNAKLYNNVGH 522
            ::|.|.:|.|..|.:               :|.|..|...| |:.|:.    :|....|      
plant   409 AEALLKLLRLDDAQRVLECVPKVEPFPASFSHTRFFDMIAEAYTSFVK----SQMELAL------ 463

  Fly   523 ALENEGKFEEALLYFQQAVRIQTDDIGAHI---NV---------GRTFNNLKRYAEAEQAYVQAK 575
                 |:||.|::..::|.:|...:....|   ||         |.....|:||.||..||.:  
plant   464 -----GRFENAVVTAEKASKIDPQNNEVEILYKNVRLITRARDRGNDLYELERYTEARSAYAE-- 521

  Fly   576 ALFPQAKPGVSYHARIAPNHLNVFINLANLIAKN---QTRLEEADHLYRQAISMRSDYVQAYINR 637
                    |:.|.    |::..:....|:...|.   ::.:|:.:|    |:.:...|.:..:.|
plant   522 --------GLKYD----PSNATLLCYRADCFFKVGMWESSIEDCNH----ALLILPSYTKPRLQR 570

  Fly   638 GDILMKLNRTAQAQEVYE---QALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHE 699
            ..:..||.|.|:|...||   :.|.||.|.|:..::             |||...|:        
plant   571 AALYTKLERWAEAVSDYEILRKELPYDKEIAESLFH-------------AQVALKKS-------- 614

  Fly   700 QALLNSAILLQELGGE 715
               ....:|..|.|||
plant   615 ---RGEVVLNMEFGGE 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 TMTC_DUF1736 323..396 CDD:462468
TPR 507..762 CDD:440225 50/227 (22%)
TPR repeat 514..542 CDD:276809 6/27 (22%)
TPR repeat 547..591 CDD:276809 13/55 (24%)
TPR repeat 598..625 CDD:276809 5/29 (17%)
TPR repeat 630..660 CDD:276809 10/32 (31%)
LapB 634..896 CDD:442196 22/85 (26%)
TPR repeat 665..693 CDD:276809 5/27 (19%)
TPR repeat 737..764 CDD:276809
TPR repeat 803..834 CDD:276809
TPR repeat 839..867 CDD:276809
TTL2NP_001319556.1 TPR repeat 258..286 CDD:276809
LapB 274..593 CDD:442196 47/216 (22%)
TPR repeat 291..321 CDD:276809
TPR repeat 402..430 CDD:276809 5/20 (25%)
TPR repeat 529..559 CDD:276809 5/33 (15%)
TPR repeat 564..588 CDD:276809 6/23 (26%)
TRX_family 635..725 CDD:239245
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.