DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and TOC64-III

DIOPT Version :10

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_188424.2 Gene:TOC64-III / 819660 AraportID:AT3G17970 Length:589 Species:Arabidopsis thaliana


Alignment Length:92 Identity:25/92 - (27%)
Similarity:43/92 - (46%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   614 EEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQ 678
            ::|..||.:||.:..:....|.||....::|....||:|...:|:..|.:|...|...|......
plant   491 QKAIGLYSEAIKLSDNNATYYSNRAAAYLELGGFLQAEEDCTKAITLDKKNVKAYLRRGTAREML 555

  Fly   679 GKSQQAQVYFNKAIELYPEHEQALLNS 705
            |..:.|...|..|:.|.|.:::|.|::
plant   556 GDCKGAIEDFRYALVLEPNNKRASLSA 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 TMTC_DUF1736 323..396 CDD:462468
TPR 507..762 CDD:440225 25/92 (27%)
TPR repeat 514..542 CDD:276809
TPR repeat 547..591 CDD:276809
TPR repeat 598..625 CDD:276809 4/10 (40%)
TPR repeat 630..660 CDD:276809 8/29 (28%)
LapB 634..896 CDD:442196 20/72 (28%)
TPR repeat 665..693 CDD:276809 6/27 (22%)
TPR repeat 737..764 CDD:276809
TPR repeat 803..834 CDD:276809
TPR repeat 839..867 CDD:276809
TOC64-IIINP_188424.2 Amidase 33..451 CDD:450241
NlpI <467..>580 CDD:443815 24/88 (27%)
TPR repeat 474..502 CDD:276809 4/10 (40%)
TPR repeat 507..537 CDD:276809 8/29 (28%)
TPR repeat 542..569 CDD:276809 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.