DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and LONRF3

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:XP_005262533.1 Gene:LONRF3 / 79836 HGNCID:21152 Length:811 Species:Homo sapiens


Alignment Length:481 Identity:99/481 - (20%)
Similarity:148/481 - (30%) Gaps:182/481 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   552 INVGRTFNNL----KRYAEAEQAYVQAKALFPQAKPGVSYHARIA----PNHLNVFINLANLIAK 608
            ::.|.||..|    .|.|:...|....|........|.:..||.|    |..|.|.:.|:.|:.|
Human   171 LSCGHTFCKLCLERGRAADRRCALCGVKLSALMVATGRARGARRAGQQPPPPLRVNVVLSGLLGK 235

  Fly   609 --------NQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLYDNENA 665
                    :|.| .|.:.|||:.      .|:|      .|:|.|...:...  ...|||.| .:
Human   236 LFPGPARASQLR-HEGNRLYRER------QVEA------ALLKYNEAVKLAP--NDHLLYSN-RS 284

  Fly   666 DIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGG-EEARRVSRSRLYKVL 729
            .||:.|.   ..:.....|::    |.:|.|...:|....|..|..||. |||   .|..||.| 
Human   285 QIYFTLE---SHENALHDAEI----ACKLRPMGFKAHFRKAQALATLGKVEEA---LREFLYCV- 338

  Fly   730 ENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLLADTKRPLDAVPFLN 794
            ..|.:|::.......|.:         .||..::  ..|.:....::..|||...|..:.|..:.
Human   339 SLDGKNKRARCEAQRLLL---------SFFSPSV--PGDSQEHSPDILKLLAPHPRLKENVESMT 392

  Fly   795 QLIRHH--------------------------------PSHVKGLILLGDIYINHMKDLDEAEK- 826
            ..:..|                                |:.||     ||...:||||.:|.|: 
Human   393 TEVTSHNLPRLLQDNLELPHCSSQEEAAARGDGSSLMDPAKVK-----GDGQQHHMKDQEEEEEK 452

  Fly   827 ----------------------------------------------------------------- 826
                                                                             
Human   453 WDATSPKAASSKTGKCQEKKRKHCQIESQEETGMPNKASKQDPPTDQGDKPALSLPLASFDASDL 517

  Fly   827 ----CYRSILHYDPHNTQGLHNLCVVFVERKRLAKAAACLQYAQRLAPAEDYIGRHL-------Q 880
                |.|  |.|:|..|...|..|:..:||        ||.:..:....:|.:.:.|       .
Human   518 ECALCMR--LFYEPVTTPCGHTFCLKCLER--------CLDHNAKCPLCKDGLSQCLASRKYSKN 572

  Fly   881 IVLARLQKINK-LPESAPERKLAYED 905
            :::..|  |.| |||...||:..||:
Human   573 VIMEEL--IAKFLPEELKERRKLYEE 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 87/437 (20%)
TPR repeat 514..542 CDD:276809
TPR repeat 547..591 CDD:276809 10/42 (24%)
TPR repeat 598..625 CDD:276809 10/34 (29%)
TPR repeat 630..660 CDD:276809 6/29 (21%)
TPR repeat 665..693 CDD:276809 5/27 (19%)
TPR repeat 737..764 CDD:276809 3/26 (12%)
TPR repeat 803..834 CDD:276809 13/100 (13%)
TPR repeat 839..867 CDD:276809 7/27 (26%)
LONRF3XP_005262533.1 RING 158..195 CDD:302633 7/23 (30%)
TPR_11 242..308 CDD:290150 21/88 (24%)
TPR repeat 243..271 CDD:276809 11/40 (28%)
TPR repeat 276..306 CDD:276809 9/37 (24%)
TPR repeat 311..334 CDD:276809 9/25 (36%)
RING 518..557 CDD:238093 12/48 (25%)
LON_substr_bdg 607..808 CDD:280370
LON 618..796 CDD:271862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.