DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and Ttc32

DIOPT Version :10

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_083597.1 Gene:Ttc32 / 75516 MGIID:1922766 Length:148 Species:Mus musculus


Alignment Length:168 Identity:36/168 - (21%)
Similarity:57/168 - (33%) Gaps:69/168 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   632 QAYINRGDILMKLNRTAQAQEVY-----------------EQALLYDNENADIYYNLGVVFLEQG 679
            ||..:||:.       |:|:|:|                 :.|..|:|.....|::  |.|.|  
Mouse    20 QARFSRGEF-------AEARELYSAFIGQCARHGSKCSPEDLATAYNNRGQTKYFS--VDFYE-- 73

  Fly   680 KSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEARRVSRSRLYKVLENDDQNEKVYFNLGM 744
                |...:..|||:.|..|..                                     |:|.|:
Mouse    74 ----AMDDYTSAIEILPSFEVP-------------------------------------YYNRGL 97

  Fly   745 LAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLLAD 782
            :......||||.:.||:|:.|...|:.|:.:|...:.|
Mouse    98 IRYRLGYFDEALEDFKKALDLNPGFQDAVLSLKQTILD 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 TMTC_DUF1736 323..396 CDD:462468
TPR 507..762 CDD:440225 30/146 (21%)
TPR repeat 514..542 CDD:276809
TPR repeat 547..591 CDD:276809
TPR repeat 598..625 CDD:276809
TPR repeat 630..660 CDD:276809 9/44 (20%)
LapB 634..896 CDD:442196 34/166 (20%)
TPR repeat 665..693 CDD:276809 6/27 (22%)
TPR repeat 737..764 CDD:276809 10/26 (38%)
TPR repeat 803..834 CDD:276809
TPR repeat 839..867 CDD:276809
Ttc32NP_083597.1 TPR 1 12..45 8/31 (26%)
NlpI <19..129 CDD:443815 34/160 (21%)
TPR 2 55..88 12/40 (30%)
TPR repeat 55..83 CDD:276809 9/35 (26%)
TPR repeat 88..118 CDD:276809 11/66 (17%)
TPR 3 89..122 12/69 (17%)
TPR repeat 123..148 CDD:276809 3/13 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.