| Sequence 1: | NP_477246.2 | Gene: | Tmtc3 / 37401 | FlyBaseID: | FBgn0020312 | Length: | 926 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_016869243.1 | Gene: | SPAG1 / 6674 | HGNCID: | 11212 | Length: | 961 | Species: | Homo sapiens |
| Alignment Length: | 298 | Identity: | 55/298 - (18%) |
|---|---|---|---|
| Similarity: | 102/298 - (34%) | Gaps: | 118/298 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 636 NRGDILMKLNRTAQAQEVYEQALLY----DNENAD----IYYNLGVVFLEQGKSQQAQVYFNKAI 692
Fly 693 ELYPEHEQALLNSAI-----------------LLQ-----ELGGEEARRVSR------------- 722
Fly 723 ----------------------------------------SRLYKVLEND------DQNEK---- 737
Fly 738 --------------VYFNLGMLAMDESSFDEAEQFFKRAIHL-----KADFRSALFNLALLLADT 783
Fly 784 KRPLDAVPFLNQLIRHHPSHVKGLILLGDI-YINHMKD 820 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tmtc3 | NP_477246.2 | DUF1736 | 323..396 | CDD:369859 | |
| PEP_TPR_lipo | <513..871 | CDD:274350 | 55/298 (18%) | ||
| TPR repeat | 514..542 | CDD:276809 | |||
| TPR repeat | 547..591 | CDD:276809 | |||
| TPR repeat | 598..625 | CDD:276809 | |||
| TPR repeat | 630..660 | CDD:276809 | 6/23 (26%) | ||
| TPR repeat | 665..693 | CDD:276809 | 8/31 (26%) | ||
| TPR repeat | 737..764 | CDD:276809 | 8/44 (18%) | ||
| TPR repeat | 803..834 | CDD:276809 | 3/19 (16%) | ||
| TPR repeat | 839..867 | CDD:276809 | |||
| SPAG1 | XP_016869243.1 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||