DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and kdm6a

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:XP_005167851.1 Gene:kdm6a / 569277 ZFINID:ZDB-GENE-081105-56 Length:1452 Species:Danio rerio


Alignment Length:401 Identity:69/401 - (17%)
Similarity:134/401 - (33%) Gaps:135/401 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 LQRRGSLSWQRFSQAALAILLL---THALKTHQRNLDWRTEY---SLFMSGV-----HVN----- 510
            |:..|.:..:.|.|.....|||   ..||..:||....:::|   :.|:.|:     |.|     
Zfish    87 LKAEGKVEPEVFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFRWA 151

  Fly   511 -----------QRNA------------------KLYNNVGHALENEGKFEEALLYFQQAV----- 541
                       ||.|                  :::..:|...:....:|.:|.:||.|:     
Zfish   152 VQLTPSDAQSGQRRAIKAFQEVLYIDPCFSRAKEIHLRLGLMFKVNTDYESSLKHFQLALIDSTP 216

  Fly   542 -RIQTDDIGAHINVGRTFNNLKRYAEAEQAY---VQAKALFPQAKPGVSYHARIAPNHLNVFINL 602
             .:...:|..||  ...:...|:|..|::||   :|.:.|..|.|                    
Zfish   217 CTLSKAEIQFHI--AHVYEIQKKYRIAKEAYESLLQTENLPAQVK-------------------- 259

  Fly   603 ANLIAKNQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLYDNENADI 667
                   .|.|::...::.....:           ||   |.|:.:.|.:..:::|..|..:...
Zfish   260 -------ATTLQQLGWMHHTVEQL-----------GD---KANKNSYAIQCLQKSLEADPNSGQS 303

  Fly   668 YYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEARRVSRSRLYKVLEND 732
            :|.||..:...||.|.|.:.:.::|                                     :..
Zfish   304 WYFLGRCYSSIGKVQDAFISYRQSI-------------------------------------DKS 331

  Fly   733 DQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLLADTKRPLDAVP-FLNQL 796
            :.:...:.::|:|...::...:|.|.:..|:.|.....:|..:|..|.....:|.||:. ::|..
Zfish   332 EASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHSHAAAWMDLGTLYESCNQPQDAIKCYINAT 396

  Fly   797 IRHHPSHVKGL 807
            .....|::..|
Zfish   397 CSKSCSNIPAL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 51/323 (16%)
TPR repeat 514..542 CDD:276809 7/51 (14%)
TPR repeat 547..591 CDD:276809 12/46 (26%)
TPR repeat 598..625 CDD:276809 2/26 (8%)
TPR repeat 630..660 CDD:276809 6/29 (21%)
TPR repeat 665..693 CDD:276809 7/27 (26%)
TPR repeat 737..764 CDD:276809 5/26 (19%)
TPR repeat 803..834 CDD:276809 1/5 (20%)
TPR repeat 839..867 CDD:276809
kdm6aXP_005167851.1 TPR 74..332 CDD:223533 54/324 (17%)
TPR repeat 95..123 CDD:276809 9/27 (33%)
TPR repeat 131..176 CDD:276809 7/44 (16%)
TPR repeat 181..211 CDD:276809 5/29 (17%)
TPR repeat 222..250 CDD:276809 8/29 (28%)
TPR repeat 260..295 CDD:276809 7/48 (15%)
TPR_17 289..320 CDD:290167 8/30 (27%)
TPR_11 302..365 CDD:290150 13/99 (13%)
TPR repeat 302..329 CDD:276809 8/63 (13%)
TPR repeat 334..364 CDD:276809 5/29 (17%)
TPR_1 335..368 CDD:278916 6/32 (19%)
TPR repeat 369..395 CDD:276809 6/25 (24%)
SSDP 572..852 CDD:282372
JmjC 1149..1213 CDD:214721
JmjC 1183..1291 CDD:202224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.