DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and Ifit1

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_064481.1 Gene:Ifit1 / 56824 RGDID:620599 Length:463 Species:Rattus norvegicus


Alignment Length:442 Identity:98/442 - (22%)
Similarity:159/442 - (35%) Gaps:139/442 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 HALKTHQRNLDWRTEYSL--------FMSGVHVNQRNAKLYNNVGHALENEGKFEEALLYFQQAV 541
            |.|:.:.|:|....|.:|        .:.|..:.:|:...:.|......:.|...||.:|..:..
  Rat    55 HNLQAYVRHLKGEQEEALQSLKEAEALIEGEQLGKRSLVTWGNCAWVHYHRGSLAEAQIYLDKVE 119

  Fly   542 RIQTDDIGAHINVGRTFNNLKRY----AEAE------------QAYVQAKALF----------PQ 580
                       ||.|.|::..||    ||.:            ..|::|.|.|          |:
  Rat   120 -----------NVCREFSSPFRYRMECAEIDCEEGWALLKCGGSNYMRAMACFAKALQVDPENPE 173

  Fly   581 AKPG---VSYHARIAPNHLN-------VFIN-----LANLIAKNQTRLEEAD----HLYRQAISM 626
            ...|   |:|......||::       |.:|     |..|:|.....|.|.|    |: .:|:|.
  Rat   174 YNAGYAVVAYRQDFDDNHVSLEPLRKAVRLNPEDPHLKVLLALKLQDLGEQDEAETHI-EEALSS 237

  Fly   627 RS--DYVQAYI-----NRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQ------ 678
            .|  .||..|.     .:|||       .:|..:..:||.....:..::|..|:.:.:|      
  Rat   238 TSCQSYVFRYAAKYFRRKGDI-------NEALHLLHRALQTSPSSGYLHYQKGLCYKQQMIQLKT 295

  Fly   679 -GKSQ------------QAQVYFNKAIELYPEHEQALLNSAILLQELGG-EEA-----RRVSRSR 724
             |..|            ||...|.:.:.|.|..|.|.:..|.:..|:|. |||     ..::.:.
  Rat   296 SGNRQARRQENIQELAHQAICEFQETLNLRPTFEMAYVCMAEMQAEIGQYEEAEGNFQEALNLNN 360

  Fly   725 LYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRA-----IH----LKADFRSALFNLALLL 780
            |...:|.|     ::|..|          .::||.|::     .|    ||.:.:|..:. .||.
  Rat   361 LVAHIEQD-----IHFRYG----------RSQQFHKKSEDKAITHYLKGLKLEEKSFAWR-KLLT 409

  Fly   781 ADTKRPLDAVPFLNQLIRHHPSHVKGLILLGDIYI---NHMKDLDEAEKCYR 829
            |     |:.|  ..:.:|.:...|:...|||.::.   ..||.|...||..|
  Rat   410 A-----LEKV--AERRVRQNVRLVESTSLLGLVFKLKGQEMKALLYYEKALR 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 90/406 (22%)
TPR repeat 514..542 CDD:276809 5/27 (19%)
TPR repeat 547..591 CDD:276809 16/72 (22%)
TPR repeat 598..625 CDD:276809 10/35 (29%)
TPR repeat 630..660 CDD:276809 9/34 (26%)
TPR repeat 665..693 CDD:276809 8/46 (17%)
TPR repeat 737..764 CDD:276809 5/31 (16%)
TPR repeat 803..834 CDD:276809 10/30 (33%)
TPR repeat 839..867 CDD:276809
Ifit1NP_064481.1 TPR repeat 136..166 CDD:276809 6/29 (21%)
Coatomer_E 158..421 CDD:252768 64/293 (22%)
TPR repeat 171..203 CDD:276809 7/31 (23%)
TPR repeat 208..236 CDD:276809 8/28 (29%)
TPR repeat 242..270 CDD:276809 8/34 (24%)
TPR repeat 275..324 CDD:276809 8/48 (17%)
TPR repeat 329..356 CDD:276809 8/26 (31%)
TPR repeat 363..396 CDD:276809 8/47 (17%)
TPR repeat 426..454 CDD:276809 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.