| Sequence 1: | NP_477246.2 | Gene: | Tmtc3 / 37401 | FlyBaseID: | FBgn0020312 | Length: | 926 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001082875.2 | Gene: | spag1a / 564953 | ZFINID: | ZDB-GENE-030131-9443 | Length: | 386 | Species: | Danio rerio |
| Alignment Length: | 214 | Identity: | 43/214 - (20%) |
|---|---|---|---|
| Similarity: | 85/214 - (39%) | Gaps: | 29/214 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 523 ALENEGKFEEALLYFQQAVRIQTDDIGAHINVGRTFNNL----------------------KRYA 565
Fly 566 EAEQAYVQAKALFPQAKPGVSYHARIAPNHLNVFINLANLIAKNQTRLEEADHLYRQAISMRSDY 630
Fly 631 VQAYINRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELY 695
Fly 696 P---EHEQALLNSAILLQE 711 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tmtc3 | NP_477246.2 | DUF1736 | 323..396 | CDD:369859 | |
| PEP_TPR_lipo | <513..871 | CDD:274350 | 43/214 (20%) | ||
| TPR repeat | 514..542 | CDD:276809 | 3/18 (17%) | ||
| TPR repeat | 547..591 | CDD:276809 | 10/65 (15%) | ||
| TPR repeat | 598..625 | CDD:276809 | 5/26 (19%) | ||
| TPR repeat | 630..660 | CDD:276809 | 10/29 (34%) | ||
| TPR repeat | 665..693 | CDD:276809 | 2/27 (7%) | ||
| TPR repeat | 737..764 | CDD:276809 | |||
| TPR repeat | 803..834 | CDD:276809 | |||
| TPR repeat | 839..867 | CDD:276809 | |||
| spag1a | NP_001082875.2 | TPR_11 | 87..157 | CDD:290150 | |
| TPR repeat | 87..112 | CDD:276809 | |||
| TPR repeat | 125..155 | CDD:276809 | |||
| TPR_11 | 128..190 | CDD:290150 | 3/20 (15%) | ||
| TPR repeat | 160..188 | CDD:276809 | 3/18 (17%) | ||
| TPR_11 | 263..326 | CDD:290150 | 15/63 (24%) | ||
| TPR repeat | 263..289 | CDD:276809 | 5/26 (19%) | ||
| TPR repeat | 294..324 | CDD:276809 | 10/29 (34%) | ||
| TPR_11 | 297..360 | CDD:290150 | 14/62 (23%) | ||
| TPR_1 | 297..328 | CDD:278916 | 10/30 (33%) | ||
| TPR repeat | 329..357 | CDD:276809 | 2/27 (7%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||