DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and Spag1

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_651514.1 Gene:Spag1 / 43239 FlyBaseID:FBgn0039463 Length:469 Species:Drosophila melanogaster


Alignment Length:402 Identity:72/402 - (17%)
Similarity:138/402 - (34%) Gaps:131/402 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   558 FNNLKRYAEAEQAYVQAKALFPQAKPGVSYHARIAPNHLNVFINLANLIAKNQTRLEEADHLYRQ 622
            :.:|:|.||.     :.|||.|.:|                       :.:.:.:::::..|.:.
  Fly    49 YPDLQRCAEE-----KLKALKPDSK-----------------------LFRYEEQIKQSTDLDKT 85

  Fly   623 AISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQ--------- 678
            .:....|:..|...:.:.|.:|.:..|            |.|......|..:.||:         
  Fly    86 ELKPILDWTDAIKTKDNALNELKKVKQ------------NLNLPSVRKLSKIDLEKESKTEKPKP 138

  Fly   679 ---------GKSQQAQVY---FNKAIELYPEHEQALLNSAILLQELGGEEARRVSRSRLYKVLEN 731
                     .|:::|::.   :.|..:..|:.|       ||..:|..|              .:
  Fly   139 APKATSPSNTKNKEARIKSTDYRKWDKYDPDEE-------ILRMDLNEE--------------RD 182

  Fly   732 DDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLLADTKRPLDAVPFLNQL 796
            .:|.||:..|.......:....|.:..::|       .::.|.||:.|..:            |.
  Fly   183 QEQREKIISNHSKSVTTDKLQSERDSLYER-------LQAQLKNLSQLEKE------------QF 228

  Fly   797 IRHHPSHVKGLILLGDIYINH---MKDLDEAEKCYRSILHYDPHN-TQGLHNLCVVFVERKR--- 854
            ...|  .::|         |.   .|:.:.|.:.|...:.|||.| ....:|..|..::.|:   
  Fly   229 AERH--RLRG---------NESFKAKEYENAIEEYNCSIIYDPENAVHAYNNRAVAHLKLKKYFS 282

  Fly   855 -LAKAAACLQYAQ-------RLAPAEDYIGRHLQIVLARLQKINKLPESAPERKLAYEDYDPLEF 911
             ::...||||...       |:|.|.:..|:||:    .|....||.:..|:..:|.:..:.|..
  Fly   283 AISDCQACLQIDPMNIKAHLRMAEAHNAEGKHLE----SLNVYKKLLDFEPDNAIAKKAVEKLTS 343

  Fly   912 KLPQDRPTHKSR 923
            .|.:..|:..:|
  Fly   344 MLGEVAPSSATR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 59/348 (17%)
TPR repeat 514..542 CDD:276809
TPR repeat 547..591 CDD:276809 9/32 (28%)
TPR repeat 598..625 CDD:276809 1/26 (4%)
TPR repeat 630..660 CDD:276809 4/29 (14%)
TPR repeat 665..693 CDD:276809 6/48 (13%)
TPR repeat 737..764 CDD:276809 4/26 (15%)
TPR repeat 803..834 CDD:276809 5/33 (15%)
TPR repeat 839..867 CDD:276809 7/38 (18%)
Spag1NP_651514.1 TPR_11 229..295 CDD:290150 17/76 (22%)
TPR repeat 229..257 CDD:276809 6/38 (16%)
TPR repeat 262..293 CDD:276809 7/30 (23%)
TPR_11 266..329 CDD:290150 16/66 (24%)
TPR 266..297 CDD:197478 7/30 (23%)
TPR repeat 298..326 CDD:276809 9/31 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.