DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and IFIT1

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_001257856.1 Gene:IFIT1 / 3434 HGNCID:5407 Length:478 Species:Homo sapiens


Alignment Length:404 Identity:77/404 - (19%)
Similarity:153/404 - (37%) Gaps:119/404 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 AKTCFTRNLALSRTLIMCLGWMVLPFLPASNLFFPV------GFVVA-------------ERILY 445
            ||.||.:.|.:.            |..|.|:..:.:      ||.:|             :.:..
Human   160 AKACFEKVLEVD------------PENPESSAGYAISAYRLDGFKLATKNHKPFSLLPLRQAVRL 212

  Fly   446 MPSMGYC-LLVAYGFEQLQRRG-SLSWQRFSQAALAILLLTHALKTHQRNLDWRTEYSLFMSGVH 508
            .|..||. :|:|.   :||..| ....:::.:.|||             |:..:|         :
Human   213 NPDNGYIKVLLAL---KLQDEGQEAEGEKYIEEALA-------------NMSSQT---------Y 252

  Fly   509 VNQRNAKLYNNVGHALENEGKFEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQ 573
            |.:..||.|       ..:|..::||...::|::.....:..|..:|..:               
Human   253 VFRYAAKFY-------RRKGSVDKALELLKKALQETPTSVLLHHQIGLCY--------------- 295

  Fly   574 AKALFPQAKPGVSYHARIAPNHLNVFINLANLIAKNQTRLEE----ADHLYRQAISMRSDYVQAY 634
             ||...|.|.......|                .:|:.:|::    |...:..|:..:..:..|:
Human   296 -KAQMIQIKEATKGQPR----------------GQNREKLDKMIRSAIFHFESAVEKKPTFEVAH 343

  Fly   635 INRGDILMKLNRTAQAQEVYEQAL----LYDNENADIYYNLGVVFLEQGKSQ-QAQVYFNKAIEL 694
            ::...:.::.....:|:|.:::.|    :.:....||:::.|.....|.||. .|.:::.|||::
Human   344 LDLARMYIEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGRFQEFQKKSDVNAIIHYLKAIKI 408

  Fly   695 YPEHEQALLNSAILLQELGGEEARRVSRSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFF 759
                |||.|.....:..|.....|::.|    |.|:.:..:     .||.:...|.:.:||.:::
Human   409 ----EQASLTRDKSINSLKKLVLRKLRR----KALDLESLS-----LLGFVYKLEGNMNEALEYY 460

  Fly   760 KRAIHLKADFRSAL 773
            :||:.|.|||.:::
Human   461 ERALRLAADFENSV 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 52/270 (19%)
TPR repeat 514..542 CDD:276809 7/27 (26%)
TPR repeat 547..591 CDD:276809 6/43 (14%)
TPR repeat 598..625 CDD:276809 4/30 (13%)
TPR repeat 630..660 CDD:276809 4/33 (12%)
TPR repeat 665..693 CDD:276809 9/28 (32%)
TPR repeat 737..764 CDD:276809 7/26 (27%)
TPR repeat 803..834 CDD:276809
TPR repeat 839..867 CDD:276809
IFIT1NP_001257856.1 TPR 1 52..85
TPR_12 54..127 CDD:290160
TPR repeat 54..80 CDD:276809
TPR 2 95..128
TPR repeat 97..123 CDD:276809
TPR repeat 128..170 CDD:276809 5/9 (56%)
TPR 3 139..174 6/25 (24%)
TPR 4 183..216 4/32 (13%)
TPR repeat 216..246 CDD:276809 10/45 (22%)
TPR 5 218..249 10/46 (22%)
TPR 6 251..284 9/48 (19%)
TPR repeat 252..279 CDD:276809 8/33 (24%)
Interaction with the 5'-triphosphate group of PPP-RNA. /evidence=ECO:0000250 256..262 3/12 (25%)
TPR repeat 284..335 CDD:276809 11/82 (13%)
TPR 7 305..339 5/49 (10%)
TPR 8 340..373 4/32 (13%)
TPR repeat 340..367 CDD:276809 3/26 (12%)
TPR 9 378..412 12/37 (32%)
TPR repeat 378..407 CDD:276809 9/28 (32%)
TPR 10 437..470 9/37 (24%)
TPR repeat 437..465 CDD:276809 7/32 (22%)
TPR_1 438..470 CDD:278916 9/36 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.