Sequence 1: | NP_477246.2 | Gene: | Tmtc3 / 37401 | FlyBaseID: | FBgn0020312 | Length: | 926 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955932.2 | Gene: | tomm34 / 323361 | ZFINID: | ZDB-GENE-030131-2081 | Length: | 305 | Species: | Danio rerio |
Alignment Length: | 320 | Identity: | 63/320 - (19%) |
---|---|---|---|
Similarity: | 106/320 - (33%) | Gaps: | 91/320 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 463 QRRGSLSWQRFSQA----------ALAILLLTHALKTHQRNLDWRTEYSLFMSGVHVNQRNAKLY 517
Fly 518 NNVGHALENEGKFEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKAL----- 577
Fly 578 -FPQAKPGV-------------SYHARIAP----------------------NHLNVFINL---- 602
Fly 603 -ANLIAKNQTRLEEADHL------------YRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVY 654
Fly 655 EQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAI--LLQEL 712 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Tmtc3 | NP_477246.2 | DUF1736 | 323..396 | CDD:369859 | |
PEP_TPR_lipo | <513..871 | CDD:274350 | 51/260 (20%) | ||
TPR repeat | 514..542 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 547..591 | CDD:276809 | 15/62 (24%) | ||
TPR repeat | 598..625 | CDD:276809 | 8/43 (19%) | ||
TPR repeat | 630..660 | CDD:276809 | 9/29 (31%) | ||
TPR repeat | 665..693 | CDD:276809 | 3/27 (11%) | ||
TPR repeat | 737..764 | CDD:276809 | |||
TPR repeat | 803..834 | CDD:276809 | |||
TPR repeat | 839..867 | CDD:276809 | |||
tomm34 | NP_955932.2 | TPR_11 | 13..83 | CDD:290150 | 13/81 (16%) |
TPR repeat | 13..38 | CDD:276809 | 5/24 (21%) | ||
TPR repeat | 43..81 | CDD:276809 | 8/49 (16%) | ||
TPR_11 | 54..116 | CDD:290150 | 15/64 (23%) | ||
TPR repeat | 86..114 | CDD:276809 | 10/30 (33%) | ||
TPR_11 | 191..254 | CDD:290150 | 15/62 (24%) | ||
TPR repeat | 191..218 | CDD:276809 | 6/26 (23%) | ||
TPR repeat | 223..253 | CDD:276809 | 9/29 (31%) | ||
TPR_11 | 226..289 | CDD:290150 | 13/62 (21%) | ||
TPR | 226..257 | CDD:197478 | 9/30 (30%) | ||
TPR_1 | 258..291 | CDD:278916 | 4/38 (11%) | ||
TPR repeat | 258..286 | CDD:276809 | 3/27 (11%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |