| Sequence 1: | NP_477246.2 | Gene: | Tmtc3 / 37401 | FlyBaseID: | FBgn0020312 | Length: | 926 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001007695.1 | Gene: | Ifit3 / 309526 | RGDID: | 1359681 | Length: | 411 | Species: | Rattus norvegicus |
| Alignment Length: | 299 | Identity: | 56/299 - (18%) |
|---|---|---|---|
| Similarity: | 120/299 - (40%) | Gaps: | 79/299 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 602 LANLIAKNQTRLE---EADHLYRQAISMRSDYVQAYINRGD---ILMKLNRTAQAQEVYEQ---- 656
Fly 657 ----ALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEA 717
Fly 718 RRVSRSRLYKVLENDDQN--EKVYFNLGMLAMDE------------------------------- 749
Fly 750 -SSFDEAEQFFKRAIHLKADFRSALFNLALL----------------LADTKRPLD-----AVPF 792
Fly 793 LNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSI 831 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tmtc3 | NP_477246.2 | DUF1736 | 323..396 | CDD:369859 | |
| PEP_TPR_lipo | <513..871 | CDD:274350 | 56/299 (19%) | ||
| TPR repeat | 514..542 | CDD:276809 | |||
| TPR repeat | 547..591 | CDD:276809 | |||
| TPR repeat | 598..625 | CDD:276809 | 6/25 (24%) | ||
| TPR repeat | 630..660 | CDD:276809 | 5/40 (13%) | ||
| TPR repeat | 665..693 | CDD:276809 | 7/27 (26%) | ||
| TPR repeat | 737..764 | CDD:276809 | 9/58 (16%) | ||
| TPR repeat | 803..834 | CDD:276809 | 6/29 (21%) | ||
| TPR repeat | 839..867 | CDD:276809 | |||
| Ifit3 | NP_001007695.1 | TPR_12 | 51..126 | CDD:290160 | 12/66 (18%) |
| TPR repeat | 51..79 | CDD:276809 | 5/18 (28%) | ||
| TPR repeat | 93..123 | CDD:276809 | 4/29 (14%) | ||
| TPR_12 | 94..164 | CDD:290160 | 14/69 (20%) | ||
| TPR repeat | 136..164 | CDD:276809 | 7/27 (26%) | ||
| TPR repeat | 206..236 | CDD:276809 | 7/29 (24%) | ||
| TPR_19 | 217..281 | CDD:291240 | 9/64 (14%) | ||
| TPR repeat | 241..269 | CDD:276809 | 4/27 (15%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||