DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and Ifit2

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_001019924.1 Gene:Ifit2 / 294091 RGDID:1307804 Length:464 Species:Rattus norvegicus


Alignment Length:407 Identity:85/407 - (20%)
Similarity:146/407 - (35%) Gaps:133/407 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 LANLIA-------KNQTRLE---EADHLYRQ----AISMRS-----DYVQAYINRGDILMK---L 644
            :.||:|       .|:..|:   ||:...||    .|.::|     :|...|.:.|.:...   |
  Rat    53 MCNLLAYVKHCRGLNEAALKCLGEAEDFIRQQHPDQIEIKSLVTWGNYAWVYYHMGQLSKAQEYL 117

  Fly   645 NRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILL 709
            ::..|..:.:......:|...|.......:...:.::::.:|.|.||:|..|::.::....||..
  Rat   118 DKVKQVCKKFSSPYRIENPVLDCEEGWARLKCTKNQNERMKVCFEKALEKDPKNPESTSGWAIAN 182

  Fly   710 QELGG-----------EEARRVSRSRLY-KV-----LENDDQNEKVYFNLGMLAMDESSF----- 752
            ..|..           |:|..:|....| ||     ||...:|.........|..|.|:.     
  Rat   183 YRLDDWPASNDYIDSLEQAISLSPDNTYVKVLLAMKLEEVHENRAKELVEEALKKDPSAIDTMLG 247

  Fly   753 -----------DEAEQFFKRAI-----------HLKADFRSALFNLALLLADT-----KRPLDAV 790
                       |.|.|..|:|:           :|...:||.:.:: |...:|     :..|:|:
  Rat   248 AAKFYVKVHDTDRAIQLLKKALESMPNNAYVHYYLGCCYRSKVLHI-LNTEETTSNGNREKLEAL 311

  Fly   791 --PFLN---------QLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSILHYD--PHNTQGL 842
              |.||         ::|.:..||:.||      |:. .|..:||:..::...:.|  |...|.|
  Rat   312 IQPALNHLRKAEDIKEMIENSCSHLAGL------YVT-TKQYEEADYYFQKEFNKDLRPLPKQLL 369

  Fly   843 H----NLCVVFVERKRLAKAAACLQYAQRLAPAEDYIGRHLQIVLARLQKINKLPESAPE----- 898
            |    |.  .|.|||  .:..|...|.:.:                   |||:  ||.|:     
  Rat   370 HLRYGNF--QFYERK--CEDRAIYHYMEGV-------------------KINR--ESKPKGKMRD 409

  Fly   899 -------RKLAYEDYDP 908
                   |:|:.::.||
  Rat   410 KLRKLALRRLSRDESDP 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 75/356 (21%)
TPR repeat 514..542 CDD:276809
TPR repeat 547..591 CDD:276809
TPR repeat 598..625 CDD:276809 9/36 (25%)
TPR repeat 630..660 CDD:276809 5/32 (16%)
TPR repeat 665..693 CDD:276809 5/27 (19%)
TPR repeat 737..764 CDD:276809 8/53 (15%)
TPR repeat 803..834 CDD:276809 7/30 (23%)
TPR repeat 839..867 CDD:276809 10/31 (32%)
Ifit2NP_001019924.1 TPR_12 51..126 CDD:290160 16/72 (22%)
TPR repeat 96..122 CDD:276809 4/25 (16%)
TPR repeat 127..167 CDD:276809 6/39 (15%)
TPR repeat 242..270 CDD:276809 5/27 (19%)
TPR repeat 275..325 CDD:276809 10/50 (20%)
TPR repeat 330..355 CDD:276809 8/31 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.