DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and Ogt

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:XP_006257118.1 Gene:Ogt / 26295 RGDID:62060 Length:1046 Species:Rattus norvegicus


Alignment Length:509 Identity:124/509 - (24%)
Similarity:213/509 - (41%) Gaps:67/509 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 FEQLQRRGSLSWQRFSQAALAILLLTHALKTHQRNLDWRTEYSLFMSGVHVNQRNAKLYNNVGHA 523
            ||..:|.....| |.......:|||..::....|.||....:|..  .:..|...|:.|:|:|:.
  Rat    37 FEAAERHCMQLW-RQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTL--AIKQNPLLAEAYSNLGNV 98

  Fly   524 LENEGKFEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQA-------------- 574
            .:..|:.:||:.:::.|:|::.|.|..:||:............|.||||.|              
  Rat    99 YKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDL 163

  Fly   575 ----KAL--FPQAKPGVSYHARIAPNHLNVFINLANLIAKNQTRLEEADHLYRQAISMRSDYVQA 633
                |||  ..:||..........||....:.|| ..:...|..:..|.|.:.:|:::..:::.|
  Rat   164 GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNL-GCVFNAQGEIWLAIHHFEKAVTLDPNFLDA 227

  Fly   634 YINRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEH 698
            |||.|::|.:.....:|...|.:||.....:|.::.||..|:.|||....|...:.:||||.|..
  Rat   228 YINLGNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHF 292

  Fly   699 EQALLNSAILLQELGG-EEARRVSRSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRA 762
            ..|..|.|..|:|.|. .||.....:.|.....:.|...    ||..:..::.:.:||.:.:::|
  Rat   293 PDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHADSLN----NLANIKREQGNIEEAVRLYRKA 353

  Fly   763 IHLKADFRSALFNLALLLADTKRPLDAVPFLNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKC 827
            :.:..:|.:|..|||.:|....:..:|:....:.||..|:.......:|:. :..|:|:..|.:|
  Rat   354 LEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNT-LKEMQDVQGALQC 417

  Fly   828 YRSILHYDPHNTQGLHNLCVVFVERKRLAKAAACLQYAQRLAPAEDY------IGRHLQIVL--- 883
            |...:..:|.......||..:..:...:.:|.|..:.|.:|.|  |:      :...||||.   
  Rat   418 YTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKP--DFPDAYCNLAHCLQIVCDWT 480

  Fly   884 ---ARLQKI----------NKLPESAPERKLAYEDYDPLEFKLPQDRPTHKSRK 924
               .|::|:          |:||...|...:.|    ||         :|..||
  Rat   481 DYDERMKKLVSIVAEQLEKNRLPSVHPHHSMLY----PL---------SHGFRK 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 93/378 (25%)
TPR repeat 514..542 CDD:276809 8/27 (30%)
TPR repeat 547..591 CDD:276809 14/63 (22%)
TPR repeat 598..625 CDD:276809 6/26 (23%)
TPR repeat 630..660 CDD:276809 10/29 (34%)
TPR repeat 665..693 CDD:276809 9/27 (33%)
TPR repeat 737..764 CDD:276809 5/26 (19%)
TPR repeat 803..834 CDD:276809 6/30 (20%)
TPR repeat 839..867 CDD:276809 5/27 (19%)
OgtXP_006257118.1 PEP_TPR_lipo <22..>465 CDD:274350 108/438 (25%)
TPR repeat 24..49 CDD:276809 4/12 (33%)
TPR repeat 57..83 CDD:276809 7/27 (26%)
TPR repeat 89..117 CDD:276809 8/27 (30%)
TPR repeat 122..152 CDD:276809 9/29 (31%)
TPR repeat 157..185 CDD:276809 5/27 (19%)
TPR repeat 191..219 CDD:276809 6/28 (21%)
TPR repeat 226..253 CDD:276809 9/26 (35%)
TPR repeat 259..287 CDD:276809 9/27 (33%)
TPR repeat 293..321 CDD:276809 8/27 (30%)
TPR repeat 327..355 CDD:276809 6/31 (19%)
TPR repeat 360..390 CDD:276809 8/29 (28%)
TPR repeat 395..423 CDD:276809 6/28 (21%)
TPR repeat 429..457 CDD:276809 5/27 (19%)
Glyco_transf_41 476..1016 CDD:404688 13/59 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.