DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and IFIT5

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_036552.1 Gene:IFIT5 / 24138 HGNCID:13328 Length:482 Species:Homo sapiens


Alignment Length:376 Identity:81/376 - (21%)
Similarity:144/376 - (38%) Gaps:109/376 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 GK-FEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAK-----PGVS 586
            || :::|...|::|:.::.|:  ...|:|......:......:..|::.:|.|..|     |..|
Human   153 GKYYQKAKAAFEKALEVEPDN--PEFNIGYAITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNS 215

  Fly   587 YHARIAPNHLNVFINL----ANLIAKNQTRLEE-ADHLYRQAISMRSDYVQAYINRGDILMKLNR 646
            |        :.||:.|    .:..|:.:..:|| .|.:..|...:|  |...:..|      .|.
Human   216 Y--------IKVFLALKLQDVHAEAEGEKYIEEILDQISSQPYVLR--YAAKFYRR------KNS 264

  Fly   647 TAQAQEVYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHE-----QALLNSA 706
            ..:|.|:.::||.....::.:::.:|:.:    ::|..|:  .||....|:.:     ..|::||
Human   265 WNKALELLKKALEVTPTSSFLHHQMGLCY----RAQMIQI--KKATHNRPKGKDKLKVDELISSA 323

  Fly   707 IL---------------------LQELGGE--EARRVSRSRLYKVLEN--DDQNEKVYFNLGMLA 746
            |.                     :...||:  .|..:.|..|.  |||  ||...:::::.|.. 
Human   324 IFHFKAAMERDSMFAFAYTDLANMYAEGGQYSNAEDIFRKALR--LENITDDHKHQIHYHYGRF- 385

  Fly   747 MDESSFDEAEQFFKR----AIH-----LKADFRSAL---FNLALLLADTKRPLDAVPFLNQLIRH 799
                     ::|.::    |||     ||...||.|   ...||....|||           :.|
Human   386 ---------QEFHRKSENTAIHHYLEALKVKDRSPLRTKLTSALKKLSTKR-----------LCH 430

  Fly   800 HPSHVKGLILLGDIYINHMKDLD----EAEKCYRSILHYDPHNTQGLHNLC 846
            :...|:.|..||.:|     .|:    :|.:.|......||.|.:.|..||
Human   431 NALDVQSLSALGFVY-----KLEGEKRQAAEYYEKAQKIDPENAEFLTALC 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 81/376 (22%)
TPR repeat 514..542 CDD:276809 5/14 (36%)
TPR repeat 547..591 CDD:276809 9/48 (19%)
TPR repeat 598..625 CDD:276809 8/31 (26%)
TPR repeat 630..660 CDD:276809 7/29 (24%)
TPR repeat 665..693 CDD:276809 5/27 (19%)
TPR repeat 737..764 CDD:276809 3/30 (10%)
TPR repeat 803..834 CDD:276809 8/34 (24%)
TPR repeat 839..867 CDD:276809 3/8 (38%)
IFIT5NP_036552.1 TPR_12 49..116 CDD:315987
TPR 1 51..84
TPR repeat 53..79 CDD:276809
TPR repeat 84..133 CDD:276809
TPR 2 94..127
TPR 3 138..173 5/19 (26%)
TPR repeat 138..168 CDD:276809 5/14 (36%)
PEP_TPR_lipo <157..470 CDD:274350 76/364 (21%)
TPR 4 181..214 5/32 (16%)
TPR repeat 214..244 CDD:276809 8/37 (22%)
TPR 5 249..282 8/40 (20%)
TPR repeat 249..277 CDD:276809 7/35 (20%)
Interaction with the 5'-triphosphate group of PPP-RNA 254..260 1/5 (20%)
TPR repeat 282..333 CDD:276809 10/56 (18%)
TPR 6 338..371 8/34 (24%)
TPR repeat 338..366 CDD:276809 4/27 (15%)
TPR 7 376..410 7/43 (16%)
TPR repeat 376..405 CDD:276809 5/38 (13%)
TPR 8 435..468 10/37 (27%)
TPR repeat 435..463 CDD:276809 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.