DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Tmtc3 and KDM6B

DIOPT Version :9

Sequence 1:	NP_477246.2	Gene:	Tmtc3 / 37401	FlyBaseID:	FBgn0020312	Length:	926	Species:	Drosophila melanogaster
Sequence 2:	NP_001073893.1	Gene:	KDM6B / 23135	HGNCID:	29012	Length:	1682	Species:	Homo sapiens

Alignment Length:	58	Identity:	18/58 - (31%)
Similarity:	27/58 - (46%)	Gaps:	5/58 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   781 ADTKRP----LDAVPFLNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSILHY 834
            |.|.||    |:::....|.:...|:.......||.:|.:. .|.:||.:||.|.|.|
Human    80 APTPRPLHGKLESLHGCVQALLREPAQPGLWEQLGQLYESE-HDSEEATRCYHSALRY 136

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Tmtc3	NP_477246.2	DUF1736	323..396	CDD:369859
		PEP_TPR_lipo	<513..871	CDD:274350	18/58 (31%)
		TPR repeat	514..542	CDD:276809
		TPR repeat	547..591	CDD:276809
		TPR repeat	598..625	CDD:276809
		TPR repeat	630..660	CDD:276809
		TPR repeat	665..693	CDD:276809
		TPR repeat	737..764	CDD:276809
		TPR repeat	803..834	CDD:276809	10/30 (33%)
		TPR repeat	839..867	CDD:276809
KDM6B	NP_001073893.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	52..88		4/7 (57%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	190..680
		Mito_fiss_reg	<566..640	CDD:283069
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	704..807
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	822..1096
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1288..1325
		JmjC	1343..1407	CDD:214721
		JmjC	1377..1485	CDD:202224
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900