powered by:
Protein Alignment Tmtc3 and KDM6B
DIOPT Version :9
Sequence 1: | NP_477246.2 |
Gene: | Tmtc3 / 37401 |
FlyBaseID: | FBgn0020312 |
Length: | 926 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001073893.1 |
Gene: | KDM6B / 23135 |
HGNCID: | 29012 |
Length: | 1682 |
Species: | Homo sapiens |
Alignment Length: | 58 |
Identity: | 18/58 - (31%) |
Similarity: | 27/58 - (46%) |
Gaps: | 5/58 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 781 ADTKRP----LDAVPFLNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSILHY 834
|.|.|| |:::....|.:...|:.......||.:|.:. .|.:||.:||.|.|.|
Human 80 APTPRPLHGKLESLHGCVQALLREPAQPGLWEQLGQLYESE-HDSEEATRCYHSALRY 136
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG1124 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.