DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and Kdm6a

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:XP_006527657.1 Gene:Kdm6a / 22289 MGIID:1095419 Length:1476 Species:Mus musculus


Alignment Length:439 Identity:82/439 - (18%)
Similarity:144/439 - (32%) Gaps:134/439 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   462 LQRRGSLSWQRFSQAALAILLL---THALKTHQRNLDWRTEYSLFMSGVHVNQRNAKLYNNVGHA 523
            |:..|.:....|.|.....|||   ..||..:||....:::|          .:||.....:|..
Mouse    87 LKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDY----------WKNAAFLYGLGLV 141

  Fly   524 LENEGKFEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAKPGVSYH 588
            ..:...|:.|:..||:.:.:...                 :..|::.:::...:|   |....|.
Mouse   142 YFHYNAFQWAIKAFQEVLYVDPS-----------------FCRAKEIHLRLGLMF---KVNTDYE 186

  Fly   589 ARIAPNHLNVFINLANLIAKNQTRLEEAD------HLYRQAISMRSDYVQAYINRGDILMKLNRT 647
            :.:  .|..:     .|:..|...|..|:      |||.......|                   
Mouse   187 SSL--KHFQL-----ALVDCNPCTLSNAEIQFHIAHLYETQRKYHS------------------- 225

  Fly   648 AQAQEVYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQEL 712
              |:|.|||.|..:|.:|.:                                     .|.:||:|
Mouse   226 --AKEAYEQLLQTENLSAQV-------------------------------------KATILQQL 251

  Fly   713 G---------GEEARRVSRSRLY--KVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLK 766
            |         |::|.:.|.:..|  |.||.|..:.:.::.||..........:|...::::|...
Mouse   252 GWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKS 316

  Fly   767 ADFRSALFNLALLLADTKRPLDAVPFLNQLIRHHPSHVKGLILLGDIY--INHMKDLDEAEKCY- 828
            ........::.:|.....:|:||:......::....|....:.||.:|  .|..:|   |.||| 
Mouse   317 EASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQD---AIKCYL 378

  Fly   829 RSILHYDPHNTQGLHNLCVVFVERKRLAKAAAC------LQYAQRLAPA 871
            .:....:..||.||       ..|.:..:|..|      ||...:|.|:
Mouse   379 NATRSKNCSNTSGL-------AARIKYLQAQLCNLPQGSLQNKTKLLPS 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 69/383 (18%)
TPR repeat 514..542 CDD:276809 6/27 (22%)
TPR repeat 547..591 CDD:276809 4/43 (9%)
TPR repeat 598..625 CDD:276809 7/32 (22%)
TPR repeat 630..660 CDD:276809 6/29 (21%)
TPR repeat 665..693 CDD:276809 1/27 (4%)
TPR repeat 737..764 CDD:276809 3/26 (12%)
TPR repeat 803..834 CDD:276809 10/33 (30%)
TPR repeat 839..867 CDD:276809 8/33 (24%)
Kdm6aXP_006527657.1 TPR repeat 95..123 CDD:276809 9/27 (33%)
TPR 108..401 CDD:223533 70/397 (18%)
TPR repeat 131..161 CDD:276809 7/29 (24%)
TPR repeat 166..196 CDD:276809 5/39 (13%)
TPR repeat 207..235 CDD:276809 10/48 (21%)
TPR repeat 287..314 CDD:276809 3/26 (12%)
TPR repeat 319..349 CDD:276809 4/29 (14%)
TPR repeat 354..380 CDD:276809 9/28 (32%)
JmjC 1151..1215 CDD:214721
JmjC 1185..1293 CDD:334913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.