DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and Kdm6b

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:XP_030101676.1 Gene:Kdm6b / 216850 MGIID:2448492 Length:1642 Species:Mus musculus


Alignment Length:262 Identity:51/262 - (19%)
Similarity:88/262 - (33%) Gaps:93/262 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 WMVLPFLPASNLFFPVGFVVAERILYMPSMGYCLLVAYGFEQLQRRGSLSWQRFSQAALAILLLT 484
            |.:|..|.|||:  ||                     |.|  :||.|.|.|             .
Mouse  1437 WPILDDLYASNI--PV---------------------YRF--VQRPGDLVW-------------I 1463

  Fly   485 HALKTHQ-------RNLDWRT------EYSLFMSGVHVNQ-RNAKLYNNVGHALENEGKFEEALL 535
            :|...|.       .|:.|..      :|.|.:.....|: :|.|....:.|...|..:      
Mouse  1464 NAGTVHWVQATGWCNNIAWNVGPLTAYQYQLALERYEWNEVKNVKSIVPMIHVSWNVAR------ 1522

  Fly   536 YFQQAVRIQTDDIGAHINVGRTFNNLK--RYAEAEQAYVQAKALFPQAKPGVSYHARIAP----- 593
                .|:|...|:         |..:|  .....:...||.::|....|. ::|..|:..     
Mouse  1523 ----TVKISDPDL---------FKMIKFCLLQSMKHCQVQRESLVRAGKK-IAYQGRVKDEPAYY 1573

  Fly   594 -NHLNVFI-NLANLIAKNQTR---LEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEV 653
             |..:|.: |:..:.::|.:|   |...:...|:    ||..:|     |.::::..||.:..:.
Mouse  1574 CNECDVEVFNILFVTSENGSRNTYLVHCEGCARR----RSAGLQ-----GVVVLEQYRTEELAQA 1629

  Fly   654 YE 655
            |:
Mouse  1630 YD 1631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 29/155 (19%)
TPR repeat 514..542 CDD:276809 3/27 (11%)
TPR repeat 547..591 CDD:276809 8/45 (18%)
TPR repeat 598..625 CDD:276809 6/30 (20%)
TPR repeat 630..660 CDD:276809 5/26 (19%)
TPR repeat 665..693 CDD:276809
TPR repeat 737..764 CDD:276809
TPR repeat 803..834 CDD:276809
TPR repeat 839..867 CDD:276809
Kdm6bXP_030101676.1 TPR repeat 106..136 CDD:276809
JmjC 1342..1406 CDD:214721
JmjC 1376..1484 CDD:396791 19/84 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.