DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and Ttc24

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_766114.1 Gene:Ttc24 / 214191 MGIID:2443841 Length:334 Species:Mus musculus


Alignment Length:151 Identity:39/151 - (25%)
Similarity:61/151 - (40%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   650 AQEVYEQAL---LYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYP------EHEQALLNS 705
            |.|.:.|||   ...:|.|.:..|||:.....|...:||.:..||..|:.      |..::....
Mouse    54 AVEAFLQALPLCRQPSEQATVLQNLGMTHNVLGNYWEAQEFHQKAASLHGSVGQRWEQGRSFSGL 118

  Fly   706 AILLQELGGEEARRVSRSRLYKVLENDDQNE-----KVYFNLGMLAMDESSFDEAEQFFKRAIHL 765
            |..|.:||  :.|....|.|:.:....|..:     :....||..|......|:|.:::|.|:.|
Mouse   119 AFSLSQLG--DHRAAWDSYLHALQAAQDTGDVKGQWQACEGLGAAAARLGQHDQALKYYKEALAL 181

  Fly   766 -KADFRSALFNLALLLADTKR 785
             :.:..|....|...|||..|
Mouse   182 CQHEPSSVRERLVAKLADAMR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 39/151 (26%)
TPR repeat 514..542 CDD:276809
TPR repeat 547..591 CDD:276809
TPR repeat 598..625 CDD:276809
TPR repeat 630..660 CDD:276809 5/12 (42%)
TPR repeat 665..693 CDD:276809 9/27 (33%)
TPR repeat 737..764 CDD:276809 7/26 (27%)
TPR repeat 803..834 CDD:276809
TPR repeat 839..867 CDD:276809
Ttc24NP_766114.1 TPR 1 35..68 5/13 (38%)
TPR repeat 38..66 CDD:276809 5/11 (45%)
TPR_12 68..144 CDD:290160 19/77 (25%)
TPR 2 72..105 10/32 (31%)
TPR repeat 72..100 CDD:276809 9/27 (33%)
TPR repeat 111..141 CDD:276809 7/31 (23%)
TPR 3 112..145 7/34 (21%)
TPR_12 113..183 CDD:290160 16/71 (23%)
TPR 4 152..185 8/32 (25%)
TPR_1 152..184 CDD:278916 8/31 (26%)
TPR repeat 152..180 CDD:276809 7/27 (26%)
TPR_12 158..214 CDD:290160 14/45 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..258
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.