DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and LONRF2

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_940863.3 Gene:LONRF2 / 164832 HGNCID:24788 Length:754 Species:Homo sapiens


Alignment Length:403 Identity:88/403 - (21%)
Similarity:152/403 - (37%) Gaps:102/403 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 ALENEGKFEEALLYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAKPGVSY 587
            :|:.:.:.|.|||...||:.:..||....:.....:..:|.|   |||...|.|.. |.:|    
Human   206 SLQRQQQPEAALLRCDQALELAPDDNSLLLLRAELYLTMKNY---EQALQDASAAC-QNEP---- 262

  Fly   588 HARIAPNHLNVFINLANLIAKNQTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQE 652
              .:...| .|.....:.:.:::..|:|  .||..|::...:.|:               .:||:
Human   263 --LLIKGH-QVKAQALSGLGRSKEVLKE--FLYCLALNPECNSVK---------------KEAQK 307

  Fly   653 VYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQALLNSAILLQELGGEEA 717
            |..:.|.  :..|:::.||......:.|:|              .|..  :|:..||:|  |:..
Human   308 VMCEVLF--SATANVHENLTSSIQSRLKAQ--------------GHSH--MNAQALLEE--GDAG 352

  Fly   718 RRVSRSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIH----------LKADFRSA 772
            ...:.|....:|.|.: :..:||.||:      .|:|.    |:|:.          ||..|...
Human   353 SSENSSEKSDMLGNTN-SSVLYFILGL------HFEED----KKALESILPTAPSAGLKRQFPDD 406

  Fly   773 LFNLALLLADTKRPLDAVPFLNQLIRHHPS----HVKGLILLGDIYINHMKDLDEAEKCYRSILH 833
            :.:...|.|..|     :|..:..::..|:    ..:||.|       .:.|. |...|.|  |.
Human   407 VEDAPDLNAPGK-----IPKKDLSLQRSPNSETEESQGLSL-------DVTDF-ECALCMR--LL 456

  Fly   834 YDPHNTQGLHNLCVVFVERKRLAKAAACLQYAQRLAPAEDYI-----GRHLQI-VLARLQKINKL 892
            ::|..|...|..|:..:||        ||.:|......:|.:     .|:..| |||.......|
Human   457 FEPVTTPCGHTFCLKCLER--------CLDHAPHCPLCKDKLSELLASRNFNITVLAEELIFRYL 513

  Fly   893 PESAPERKLAYED 905
            |:...:||..|::
Human   514 PDELSDRKRIYDE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 77/361 (21%)
TPR repeat 514..542 CDD:276809 7/18 (39%)
TPR repeat 547..591 CDD:276809 10/43 (23%)
TPR repeat 598..625 CDD:276809 6/26 (23%)
TPR repeat 630..660 CDD:276809 5/29 (17%)
TPR repeat 665..693 CDD:276809 5/27 (19%)
TPR repeat 737..764 CDD:276809 8/26 (31%)
TPR repeat 803..834 CDD:276809 8/30 (27%)
TPR repeat 839..867 CDD:276809 8/27 (30%)
LONRF2NP_940863.3 TPR 1 23..58
TPR_16 27..92 CDD:372602
TPR 2 59..91
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..136
RING1-HC_LONFs 143..174 CDD:319427
TPR 3 197..230 7/23 (30%)
TPR repeat 200..225 CDD:276809 7/18 (39%)
TPR repeat 230..260 CDD:276809 8/33 (24%)
TPR 4 231..264 9/42 (21%)
TPR repeat 265..293 CDD:276809 6/30 (20%)
TPR 5 266..298 7/34 (21%)
PEX10 <380..489 CDD:227861 29/135 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 398..439 8/45 (18%)
RING2-HC_LONFs 446..487 CDD:319428 14/51 (27%)
TPR 6 447..483 13/46 (28%)
RING-HC finger (C3HC4-type) 449..486 CDD:319428 12/46 (26%)
LON_substr_bdg 538..738 CDD:366967
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.