| Sequence 1: | NP_477246.2 | Gene: | Tmtc3 / 37401 | FlyBaseID: | FBgn0020312 | Length: | 926 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001099139.2 | Gene: | TTC24 / 164118 | HGNCID: | 32348 | Length: | 582 | Species: | Homo sapiens |
| Alignment Length: | 298 | Identity: | 71/298 - (23%) |
|---|---|---|---|
| Similarity: | 115/298 - (38%) | Gaps: | 47/298 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 519 NVGHALENEGKFEEALLYFQQAV---RIQTDDIGAHINVGRTFNNLKR-------YAEAEQAYVQ 573
Fly 574 -----AKALFPQAKPGVSYHA-RIAPNHLNVFINLANLIAKNQTRLEEADHLYRQAISMRSDYVQ 632
Fly 633 AYINRGDILMKLNRTAQAQEVYEQAL---LYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIEL 694
Fly 695 YP------EHEQALLNSAILLQELGGEEARRVSRSRLYKVLENDDQNE-----KVYFNLGMLAMD 748
Fly 749 ESSFDEAEQFFKRAI-HLKADFRSALFNLALLLADTKR 785 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Tmtc3 | NP_477246.2 | DUF1736 | 323..396 | CDD:369859 | |
| PEP_TPR_lipo | <513..871 | CDD:274350 | 71/298 (24%) | ||
| TPR repeat | 514..542 | CDD:276809 | 7/25 (28%) | ||
| TPR repeat | 547..591 | CDD:276809 | 14/56 (25%) | ||
| TPR repeat | 598..625 | CDD:276809 | 5/26 (19%) | ||
| TPR repeat | 630..660 | CDD:276809 | 7/32 (22%) | ||
| TPR repeat | 665..693 | CDD:276809 | 9/27 (33%) | ||
| TPR repeat | 737..764 | CDD:276809 | 7/27 (26%) | ||
| TPR repeat | 803..834 | CDD:276809 | |||
| TPR repeat | 839..867 | CDD:276809 | |||
| TTC24 | NP_001099139.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..31 | ||
| TPR_12 | 36..105 | CDD:290160 | |||
| TPR 1 | 36..69 | ||||
| TPR repeat | 36..64 | CDD:276809 | |||
| TPR 2 | 79..112 | ||||
| TPR_12 | 80..148 | CDD:290160 | 7/25 (28%) | ||
| TPR repeat | 81..111 | CDD:276809 | |||
| TPR repeat | 116..146 | CDD:276809 | 7/23 (30%) | ||
| TPR 3 | 117..150 | 7/27 (26%) | |||
| TPR_11 | 121..180 | CDD:290150 | 12/57 (21%) | ||
| TPR 4 | 154..187 | 8/32 (25%) | |||
| TPR repeat | 154..180 | CDD:276809 | 3/25 (12%) | ||
| TPR_12 | 232..302 | CDD:290160 | 21/83 (25%) | ||
| TPR 5 | 236..271 | 11/48 (23%) | |||
| TPR repeat | 238..264 | CDD:276809 | 9/39 (23%) | ||
| TPR_12 | 271..345 | CDD:290160 | 19/75 (25%) | ||
| TPR 6 | 273..306 | 10/32 (31%) | |||
| TPR | 273..302 | CDD:197478 | 9/28 (32%) | ||
| TPR repeat | 273..301 | CDD:276809 | 9/27 (33%) | ||
| TPR repeat | 312..342 | CDD:276809 | 7/31 (23%) | ||
| TPR 7 | 313..346 | 7/34 (21%) | |||
| TPR_12 | 314..385 | CDD:290160 | 15/72 (21%) | ||
| TPR 8 | 353..386 | 7/32 (22%) | |||
| TPR repeat | 353..381 | CDD:276809 | 7/27 (26%) | ||
| TPR_1 | 353..>380 | CDD:278916 | 6/26 (23%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 418..481 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 548..582 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||