DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and Ifit2

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_001342191.1 Gene:Ifit2 / 15958 MGIID:99449 Length:470 Species:Mus musculus


Alignment Length:390 Identity:81/390 - (20%)
Similarity:146/390 - (37%) Gaps:125/390 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 NLIAKNQTRLEEADHLYRQAISMRSDY------VQAYIN--RGDILMKLNRTA-----------Q 649
            ||||::::..|..|.::.:.....|::      :.||:.  ||     ||..|           |
Mouse    23 NLIAEDESLDEFEDRVFNKDEFQNSEFKATMCNILAYVKHCRG-----LNEAALQCLGEAEGFIQ 82

  Fly   650 AQ---EVYEQALLYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIELYPEHEQ--ALLNSAILL 709
            .|   :|..::|:.....|.:||::       |:..:||.|.:|..::..:...  .:.|.|:..
Mouse    83 QQHPDQVEIRSLVTWGNYAWVYYHM-------GQFSKAQAYLDKVKQVCKKFSSPYRIENPALDC 140

  Fly   710 QELGGEEARRVSRSR-------LYKVLENDDQNEKVYFNLGMLAMDESSFDE--AEQF----FKR 761
            :|  |....:.::::       ..|.||.|.:|.:  |..|. |:.....|:  |..:    .::
Mouse   141 EE--GWARLKCTKNQNERVKVCFQKALEKDPKNPE--FTSGW-AIANYRLDDWPARNYCIDSLEQ 200

  Fly   762 AIHLKADFRSALFNLALLLADTKRPLDAVPFLNQLIRHHPSHVKGLILLGDIYINHMKDLDEA-- 824
            ||.|..|.......|||.| |......|:..:.:.::..||.:..|:.....|.. :.|.|.|  
Mouse   201 AIQLSPDNTYVKVLLALKL-DAVHKNQAMALVEEALKKDPSAIDTLLRAARFYCK-VYDTDRAIQ 263

  Fly   825 ------EK-------------CYRSILHYDPHNTQGLHNLCVVFV-ERKRLAKAAACLQYAQRLA 869
                  ||             ||||.:|:      .|:...:||. :||:|.:.           
Mouse   264 LLRKALEKLPNNAYVHYYMGCCYRSKVHH------MLNRREMVFSGDRKKLEEL----------- 311

  Fly   870 PAEDYIGRHLQIVLARLQKINKLPESAPERKLAY------------EDYDPLEF----KLPQDRP 918
                     :|:.:..|:|..::.|     .|.|            :.||..::    :|.:|.|
Mouse   312 ---------IQLAVNHLRKAEEIKE-----MLEYSCSFLADLYIIAKKYDEADYYFQKELSKDLP 362

  Fly   919  918
            Mouse   363  362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 70/325 (22%)
TPR repeat 514..542 CDD:276809
TPR repeat 547..591 CDD:276809
TPR repeat 598..625 CDD:276809 6/20 (30%)
TPR repeat 630..660 CDD:276809 11/51 (22%)
TPR repeat 665..693 CDD:276809 8/27 (30%)
TPR repeat 737..764 CDD:276809 6/32 (19%)
TPR repeat 803..834 CDD:276809 11/51 (22%)
TPR repeat 839..867 CDD:276809 6/28 (21%)
Ifit2NP_001342191.1 TPR 1 51..89 9/42 (21%)
TPR 2 90..135 9/51 (18%)
TPR repeat 96..122 CDD:276809 8/32 (25%)
TPR repeat 127..167 CDD:276809 6/41 (15%)
TPR 3 136..171 7/36 (19%)
PEP_TPR_lipo <145..359 CDD:274350 49/249 (20%)
TPR 4 172..208 8/38 (21%)
TPR 5 242..275 7/33 (21%)
TPR repeat 242..270 CDD:276809 5/28 (18%)
TPR repeat 275..325 CDD:276809 14/75 (19%)
TPR 6 276..331 16/85 (19%)
TPR repeat 330..358 CDD:276809 3/27 (11%)
TPR 7 332..362 4/29 (14%)
TPR 8 363..401 81/390 (21%)
TPR 9 402..443
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 439..470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.