DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and Ifit1

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_032357.2 Gene:Ifit1 / 15957 MGIID:99450 Length:463 Species:Mus musculus


Alignment Length:358 Identity:75/358 - (20%)
Similarity:134/358 - (37%) Gaps:103/358 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 AILLLTHALKTHQRNLDWRTEYSL----------FMS------GVHVNQRNAKL-------YNNV 520
            |:.....|||....|.::.|.|::          |:|      .|.:|..:..|       ..::
Mouse   157 AMACFAKALKVEPENPEYNTGYAVVAYRQDLDDNFISLEPLRKAVRLNPEDPYLKVLLALKLQDL 221

  Fly   521 GHALENEGKFEEAL--------------LYFQQAVRIQTDDIGAHINVGRTFNNLKRYAEAEQAY 571
            |..:|.|...||||              .||::..|:   |...|:        |.|..:|..: 
Mouse   222 GEHVEAEAHIEEALSSTSCQSYVIRYAAKYFRRKHRV---DKALHL--------LNRALQASPS- 274

  Fly   572 VQAKALFPQAKPGVSYHARIAPNHLNVFINLANLIAKNQTRLEE----ADHLYRQAISMRSDYVQ 632
                :.:...:.|:.|..:|:....:     .|...:.|..::|    |.|.:::.:.:|..:..
Mouse   275 ----SGYLHYQKGLCYKQQISQLRTS-----RNRQPRRQDNVQELAQQAIHEFQETLKLRPTFEM 330

  Fly   633 AYINRGDILMKLNRTAQAQEVYEQAL----LYDNENADIYYNLGVVFLEQGKSQQAQVYFNKAIE 693
            ||:...::..::::..:|:..:::||    |..:...||:...| .||:..|..:     :|||.
Mouse   331 AYVCMAEVQAEIHQYEEAERNFQKALNNKTLVAHIEQDIHLRYG-RFLQFHKQSE-----DKAIT 389

  Fly   694 LYPEHEQALLNSAILLQELGGEE---ARRVSRSRLYKVLENDDQNEKVYFNLGMLAMDESSFDEA 755
            ||             |:.|..||   |.|...:.|.||.|     .:|..|:.::        |:
Mouse   390 LY-------------LKGLKVEEKSFAWRKLLTALEKVAE-----RRVCQNVHLV--------ES 428

  Fly   756 EQFFKRAIHLKADFRSALF--NLALLLADTKRP 786
            .........||...::|||  ..||.|.....|
Mouse   429 TSLLGLVYKLKGQEKNALFYYEKALRLTGEMNP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 64/308 (21%)
TPR repeat 514..542 CDD:276809 10/48 (21%)
TPR repeat 547..591 CDD:276809 7/43 (16%)
TPR repeat 598..625 CDD:276809 5/30 (17%)
TPR repeat 630..660 CDD:276809 5/33 (15%)
TPR repeat 665..693 CDD:276809 8/27 (30%)
TPR repeat 737..764 CDD:276809 3/26 (12%)
TPR repeat 803..834 CDD:276809
TPR repeat 839..867 CDD:276809
Ifit1NP_032357.2 TPR 1 52..85
TPR_12 54..124 CDD:290160
TPR repeat 55..86 CDD:276809
TPR repeat 91..121 CDD:276809
TPR 2 92..126
TPR 3 136..171 4/13 (31%)
TPR repeat 136..166 CDD:276809 2/8 (25%)
TPR_16 145..208 CDD:290168 11/50 (22%)
TPR repeat 171..203 CDD:276809 6/31 (19%)
TPR 4 174..207 6/32 (19%)
type_IV_pilW <194..354 CDD:131573 30/180 (17%)
TPR repeat 208..236 CDD:276809 7/27 (26%)
TPR 5 209..241 8/31 (26%)
TPR 6 242..275 8/48 (17%)
TPR repeat 242..270 CDD:276809 7/38 (18%)
Interaction with the 5'-triphosphate group of PPP-RNA. /evidence=ECO:0000250 247..253 1/5 (20%)
TPR repeat 275..324 CDD:276809 8/53 (15%)
TPR 7 294..328 6/38 (16%)
TPR 8 329..362 5/32 (16%)
TPR repeat 329..356 CDD:276809 3/26 (12%)
TPR 9 367..401 15/52 (29%)
TPR 10 426..459 9/40 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.