DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tmtc3 and TTC32

DIOPT Version :9

Sequence 1:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster
Sequence 2:NP_001008238.1 Gene:TTC32 / 130502 HGNCID:32954 Length:151 Species:Homo sapiens


Alignment Length:145 Identity:40/145 - (27%)
Similarity:60/145 - (41%) Gaps:16/145 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 AHINVGRTFNNLKRYAEAE---QAYVQ--AKALFPQAKPGVSYHARIAPNHLNVFINLANLIAKN 609
            ||.|.|       .|||||   .||::  |.|......||    ::.:|..|....|....|...
Human    17 AHFNNG-------EYAEAEALYSAYIRRCACAASSDESPG----SKCSPEDLATAYNNRGQIKYF 70

  Fly   610 QTRLEEADHLYRQAISMRSDYVQAYINRGDILMKLNRTAQAQEVYEQALLYDNENADIYYNLGVV 674
            :....||...|..||.::.::...|.|||.||.:|.....|.|.:::.|..:....|...:|...
Human    71 RVDFYEAMDDYTSAIEVQPNFEVPYYNRGLILYRLGYFDDALEDFKKVLDLNPGFQDATLSLKQT 135

  Fly   675 FLEQGKSQQAQVYFN 689
            .|::.:.|:..|..|
Human   136 ILDKEEKQRRNVAKN 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 40/145 (28%)
TPR repeat 514..542 CDD:276809
TPR repeat 547..591 CDD:276809 15/45 (33%)
TPR repeat 598..625 CDD:276809 6/26 (23%)
TPR repeat 630..660 CDD:276809 10/29 (34%)
TPR repeat 665..693 CDD:276809 6/25 (24%)
TPR repeat 737..764 CDD:276809
TPR repeat 803..834 CDD:276809
TPR repeat 839..867 CDD:276809
TTC32NP_001008238.1 TPR_11 2..>143 CDD:330823 37/136 (27%)
TPR 1 8..41 12/30 (40%)
PLN03088 <55..>123 CDD:330826 18/67 (27%)
TPR repeat 57..87 CDD:276809 8/29 (28%)
TPR 2 58..91 7/32 (22%)
TPR 3 92..125 10/32 (31%)
TPR repeat 92..120 CDD:276809 9/27 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.