DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ktub and TLP1

DIOPT Version :9

Sequence 1:NP_611549.2 Gene:ktub / 37400 FlyBaseID:FBgn0015721 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001319391.1 Gene:TLP1 / 844025 AraportID:AT1G76900 Length:455 Species:Arabidopsis thaliana


Alignment Length:339 Identity:100/339 - (29%)
Similarity:153/339 - (45%) Gaps:99/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 QPAPQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKKIFLLGGRKRKKSKTSNYIVSCDPTDL 291
            ||.|:....:|.|.||:..:...|:......|..:.||  |||..::.:::..:.|::|.....:
plant   120 QPGPRDATMQCFIKRDKSNLTYHLYLCLSPALLVENGK--FLLSAKRIRRTTYTEYVISMHADTI 182

  Fly   292 SRNADGFCGKLRSNVFGTSFTVFD-----NGN--------------KESTESPRL-----DLAVI 332
            ||:::.:.||:|||..||.|.::|     |.|              .....||::     .:|.:
plant   183 SRSSNTYIGKIRSNFLGTKFIIYDTQPAYNSNIARAVQPVGLSRRFYSKRVSPKVPSGSYKIAQV 247

  Fly   333 IYDTNILGFKGPRNM----------------------TVILPGMTEDDQRVKISSADPK------ 369
            .|:.|:||.:|||.|                      .:|:|....|:....|:|:..:      
plant   248 SYELNVLGTRGPRRMHCAMNSIPASSLAEGGTVPGQPDIIVPRSILDESFRSITSSSSRKITYDY 312

  Fly   370 -------------------QQGILDLWKMKNMDNIVELHNKTPVWNDETQSYVLNFHGRVTQASV 415
                               |:.:|:..|.:|...:| |.||.|.|:::.|.:.|||.||||.|||
plant   313 SNDFSSARFSDILGPLSEDQEVVLEEGKERNSPPLV-LKNKPPRWHEQLQCWCLNFRGRVTVASV 376

  Fly   416 KNFQLV-------------------------HDSDPEYIVMQFGRTSEDVFTMDYRYPLCAMQAF 455
            |||||:                         ....|:.|::|||:..:|:||||:||||.|.|||
plant   377 KNFQLIAANQPQPQPQPQPQPQPLTQPQPSGQTDGPDKIILQFGKVGKDMFTMDFRYPLSAFQAF 441

  Fly   456 AIALSSFDGKIACE 469
            ||.|||||.|:|||
plant   442 AICLSSFDTKLACE 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ktubNP_611549.2 Tub 228..462 CDD:279506 92/329 (28%)
TLP1NP_001319391.1 F-box-like 57..>99 CDD:372399
Tub 120..450 CDD:366500 95/332 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1448
eggNOG 1 0.900 - - E1_KOG2502
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I1660
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445357at2759
OrthoFinder 1 1.000 - - FOG0000431
OrthoInspector 1 1.000 - - otm2426
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16517
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X288
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.