DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ktub and TLP11

DIOPT Version :9

Sequence 1:NP_611549.2 Gene:ktub / 37400 FlyBaseID:FBgn0015721 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_197369.2 Gene:TLP11 / 831986 AraportID:AT5G18680 Length:389 Species:Arabidopsis thaliana


Alignment Length:298 Identity:107/298 - (35%)
Similarity:153/298 - (51%) Gaps:66/298 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 QPAPQGVLYKCRITRDRKGMDRGLFPIYYLHLE-----RDYGKKIFLLGGRKRKKSKTSNYIVSC 286
            ||.|:..|.:|.|.|:|      :...|:|:|.     .|.||  |||...|.|.:..::||:|.
plant   103 QPGPRDSLVQCFIKRNR------ITQSYHLYLGLTNSLTDDGK--FLLAACKLKHTTCTDYIISL 159

  Fly   287 DPTDLSRNADGFCGKLRSNVFGTSFTVFDNGNKESTESPRL--------------------DLAV 331
            ...|:||.:..:.||:|||..||.|||||.....||.:.:|                    .:|.
plant   160 RSDDMSRRSQAYVGKVRSNFLGTKFTVFDGNLLPSTGAAKLRKSRSYNPAKVSAKVPLGSYPVAH 224

  Fly   332 IIYDTNILGFKGPRNMTVI---LPGMTEDDQRVKISSADPKQ------QGILDLWKMKNM----- 382
            |.|:.|:||.:|||.|..:   :|..|.:.|.|   :::|.:      :..|...:.|.:     
plant   225 ITYELNVLGSRGPRKMQCLMDTIPTSTMEPQGV---ASEPSEFPLLGTRSTLSRSQSKPLRSSSS 286

  Fly   383 ---DNIVELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQLV-------------HDSDPEYIVM 431
               :..:.|.||||.|:::.:.:.||||||||.|||||||||             .:...|.|::
plant   287 HLKETPLVLSNKTPRWHEQLRCWCLNFHGRVTVASVKNFQLVAAGASCGSGTGMSPERQSERIIL 351

  Fly   432 QFGRTSEDVFTMDYRYPLCAMQAFAIALSSFDGKIACE 469
            |||:..:|:|||||.||:.|.|||||.||||:.:||||
plant   352 QFGKVGKDMFTMDYGYPISAFQAFAICLSSFETRIACE 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ktubNP_611549.2 Tub 228..462 CDD:279506 100/288 (35%)
TLP11NP_197369.2 Tub 103..384 CDD:395929 103/291 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1448
eggNOG 1 0.900 - - E1_KOG2502
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I1660
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445357at2759
OrthoFinder 1 1.000 - - FOG0000431
OrthoInspector 1 1.000 - - otm2426
orthoMCL 1 0.900 - - OOG6_101683
Panther 1 1.100 - - O PTHR16517
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X288
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.