DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ktub and TLP3

DIOPT Version :9

Sequence 1:NP_611549.2 Gene:ktub / 37400 FlyBaseID:FBgn0015721 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001189775.1 Gene:TLP3 / 819402 AraportID:AT2G47900 Length:407 Species:Arabidopsis thaliana


Alignment Length:305 Identity:110/305 - (36%)
Similarity:158/305 - (51%) Gaps:74/305 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 QPAPQGVLYKCRITRDRKGMDRGLFPIYYLHL-------ERDYGKKIFLLGGRKRKKSKTSNYIV 284
            ||.|:|.|.:|.|.|:|...      .|||:|       ..|.||  |||..::.::...::||:
plant   115 QPGPRGSLVQCYIMRNRSNQ------TYYLYLGLNQAAASNDDGK--FLLAAKRFRRPTCTDYII 171

  Fly   285 SCDPTDLSRNADGFCGKLRSNVFGTSFTVFD----NGNKESTE------------SPRL-----D 328
            |.:..|:||.::.:.||||||..||.|||:|    |...:.|.            |||:     .
plant   172 SLNCDDVSRGSNTYIGKLRSNFLGTKFTVYDAQPTNPGTQVTRTRSSRLLSLKQVSPRIPSGNYP 236

  Fly   329 LAVIIYDTNILGFKGPRNMTVIL---------PGMTEDDQRVKISS---ADPKQQGILDLWKMKN 381
            :|.|.|:.|:||.:|||.|..::         ||.|...|...:.|   :.|.    ...::.|:
plant   237 VAHISYELNVLGSRGPRRMQCVMDAIPASAVEPGGTAPTQTELVHSNLDSFPS----FSFFRSKS 297

  Fly   382 M---------------DNIVELHNKTPVWNDETQSYVLNFHGRVTQASVKNFQLV-----HDSDP 426
            :               :.::.|.||.|.|:::.|.:.|||:||||.|||||||||     ..:.|
plant   298 IRAESLPSGPSSAAQKEGLLVLKNKAPRWHEQLQCWCLNFNGRVTVASVKNFQLVAAPENGPAGP 362

  Fly   427 EY--IVMQFGRTSEDVFTMDYRYPLCAMQAFAIALSSFDGKIACE 469
            |:  :::|||:..:|||||||:||:.|.|||.|.|||||.|||||
plant   363 EHENVILQFGKVGKDVFTMDYQYPISAFQAFTICLSSFDTKIACE 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ktubNP_611549.2 Tub 228..462 CDD:279506 101/295 (34%)
TLP3NP_001189775.1 F-box 50..95 CDD:395521
Tub 115..402 CDD:395929 104/298 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1448
eggNOG 1 0.900 - - E1_KOG2502
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I1660
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445357at2759
OrthoFinder 1 1.000 - - FOG0000431
OrthoInspector 1 1.000 - - otm2426
orthoMCL 1 0.900 - - OOG6_101683
Panther 1 1.100 - - O PTHR16517
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X288
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.870

Return to query results.
Submit another query.