DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ktub and TLP2

DIOPT Version :9

Sequence 1:NP_611549.2 Gene:ktub / 37400 FlyBaseID:FBgn0015721 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001031369.1 Gene:TLP2 / 816344 AraportID:AT2G18280 Length:394 Species:Arabidopsis thaliana


Alignment Length:286 Identity:97/286 - (33%)
Similarity:146/286 - (51%) Gaps:46/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 QPAPQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKKIFLLGGRKRKKSKTSNYIVSCDPTDL 291
            ||.|:....:|.|.|:|.   ...:.:||..:..:......||..|:.:::..:::|:|....:.
plant   111 QPGPRDSPIQCFIKRNRA---TATYILYYGLMPSETENDKLLLAARRIRRATCTDFIISLSAKNF 172

  Fly   292 SRNADGFCGKLRSNVFGTSFTVFDNGNKEST-------------ESPRL-----DLAVIIYDTNI 338
            ||::..:.|||||...||.||::||....||             .:|:|     .:..|.|:.|:
plant   173 SRSSSTYVGKLRSGFLGTKFTIYDNQTASSTAQAQPNRRLHPKQAAPKLPTNSSTVGNITYELNV 237

  Fly   339 LGFKGPRNM-----------TVILPGMTEDDQRVKISSADPKQQGILDLWKMKN-----MDNIVE 387
            |..:|||.|           .:..|.:.:..:....||..||.:.|....::.:     .|..:.
plant   238 LRTRGPRRMHCAMDSIPLSSVIAEPSVVQGIEEEVSSSPSPKGETITTDKEIPDNSPSLRDQPLV 302

  Fly   388 LHNKTPVWNDETQSYVLNFHGRVTQASVKNFQLVHDSDP---------EYIVMQFGRTSEDVFTM 443
            |.||:|.|:::.|.:.|||.||||.|||||||||.:.|.         |.:::|||:..:|:|||
plant   303 LKNKSPRWHEQLQCWCLNFKGRVTVASVKNFQLVAEIDASLDAPPEEHERVILQFGKIGKDIFTM 367

  Fly   444 DYRYPLCAMQAFAIALSSFDGKIACE 469
            ||||||.|.|||||.:||||.|.|||
plant   368 DYRYPLSAFQAFAICISSFDTKPACE 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ktubNP_611549.2 Tub 228..462 CDD:279506 89/276 (32%)
TLP2NP_001031369.1 F-box-like 48..>91 CDD:289689
Tub 112..386 CDD:279506 89/276 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 147 1.000 Domainoid score I1448
eggNOG 1 0.900 - - E1_KOG2502
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I1660
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445357at2759
OrthoFinder 1 1.000 - - FOG0000431
OrthoInspector 1 1.000 - - otm2426
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16517
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X288
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.970

Return to query results.
Submit another query.