DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ktub and tulp1b

DIOPT Version :9

Sequence 1:NP_611549.2 Gene:ktub / 37400 FlyBaseID:FBgn0015721 Length:469 Species:Drosophila melanogaster
Sequence 2:XP_021332987.1 Gene:tulp1b / 571108 ZFINID:ZDB-GENE-110411-113 Length:316 Species:Danio rerio


Alignment Length:207 Identity:73/207 - (35%)
Similarity:106/207 - (51%) Gaps:43/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SRNHSNNMRSLSTINQEGKWSYTPRKADLIEEISSHELEDEESSPVT-VIEQHQQSASHSANSTQ 152
            |:.......|:..||.|...:.:.:||...|       .:|||.|.| ..:..::|:|::|:..|
Zfish   139 SKTKKKEPASMFQINGEKPETKSKKKAAKSE-------SEEESEPETKTSKTKKKSSSNTASMFQ 196

  Fly   153 SQKPRARQHSFSDNLDEDDYTNRNVAGAAPVRPAGMASSPYKDATLDGSSNGT-----GNGTGGE 212
            :          ..:.|:|..|.:.            .||...:.|.|..|..|     |.|..|:
Zfish   197 T----------GGDKDKDKKTKKT------------KSSAKAEETEDSDSEVTQKKKKGKGKKGK 239

  Fly   213 SE----GDVI--GNIDQFVMQPAPQGVLYKCRITRDRKGMDRGLFPIYYLHLERDYGKKIFLLGG 271
            .|    ..||  .|:::||:|||.|||..||::|||::|||:||:|.|||||:.:  ||:|||.|
Zfish   240 KEERAPSPVIEFNNLEEFVLQPAEQGVTVKCKVTRDKRGMDKGLYPTYYLHLDNE--KKVFLLAG 302

  Fly   272 RKRKKSKTSNYI 283
            ||||||.||||:
Zfish   303 RKRKKSTTSNYL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ktubNP_611549.2 Tub 228..462 CDD:279506 37/56 (66%)
tulp1bXP_021332987.1 Tub 261..>316 CDD:307359 37/56 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 344 1.000 Domainoid score I1027
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1445357at2759
OrthoFinder 1 1.000 - - FOG0000431
OrthoInspector 1 1.000 - - otm24451
orthoMCL 1 0.900 - - OOG6_101683
Panther 1 1.100 - - O PTHR16517
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X288
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.