DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9394 and glpQ

DIOPT Version :10

Sequence 1:NP_611548.1 Gene:CG9394 / 37399 FlyBaseID:FBgn0034588 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_416742.1 Gene:glpQ / 946725 ECOCYCID:EG10399 Length:358 Species:Escherichia coli


Alignment Length:212 Identity:56/212 - (26%)
Similarity:97/212 - (45%) Gaps:37/212 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 IGHRGLGKSLTVTTNAAPLIENTVATMLASSELGADLVEFDVQLTSD--LVPIIHHDFSIRVC-I 408
            |.|||.         :..|.|:|:.....:...|||.:|.|:.:|.|  || ::|..:..||. :
E. coli    34 IAHRGA---------SGYLPEHTLPAKAMAYAQGADYLEQDLVMTKDDNLV-VLHDHYLDRVTDV 88

  Fly   409 DSKTP--TSKD------DLTEVLLKDISYEQLKDLKTYQIVGNKIVEYPAHNNVEPPEQRL--FP 463
            ..:.|  ..||      |.|...:|.:.:.:..|::.    |.|:..||....:...:.|:  |.
E. coli    89 ADRFPDRARKDGRYYAIDFTLDEIKSLKFTEGFDIEN----GKKVQTYPGRFPMGKSDFRVHTFE 149

  Fly   464 TLQDFFERVNLSTGFDIEIKWPQQRADGLFESEQTLDKNLFADRILAVVRRHG-CGRLN--VIKS 525
            ...:|.:.:|.|||.:|.| :|:.:|. .|..::..|   .|.:.|.|::::| .|:.:  .::.
E. coli   150 EEIEFVQGLNHSTGKNIGI-YPEIKAP-WFHHQEGKD---IAAKTLEVLKKYGYTGKDDKVYLQC 209

  Fly   526 FDADLCSLLRFKQHMYP 542
            ||||  .|.|.|..:.|
E. coli   210 FDAD--ELKRIKNELEP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9394NP_611548.1 CBM20 47..169 CDD:449530
GDPD_GDE5 345..630 CDD:176549 56/212 (26%)
glpQNP_416742.1 glpQ 5..358 CDD:236859 56/212 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.