DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9394 and Gdpd2

DIOPT Version :10

Sequence 1:NP_611548.1 Gene:CG9394 / 37399 FlyBaseID:FBgn0034588 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_076097.1 Gene:Gdpd2 / 71584 MGIID:1918834 Length:539 Species:Mus musculus


Alignment Length:184 Identity:46/184 - (25%)
Similarity:83/184 - (45%) Gaps:41/184 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 IGHRGLGKSLTVTTNAAPLI--ENTVATMLASSELGADLVEFDVQLTSDLVPIIHHDFSIRVCID 409
            :||||           ||::  |||:.::..::|.||.:.|.||.::||.||.:.||..:     
Mouse   228 VGHRG-----------APMLAPENTLMSLRKTAECGAAVFETDVMVSSDGVPFLMHDERL----- 276

  Fly   410 SKTPTSKDDLTEVL---LKDISYEQLKDLKTYQIVGNKIVEYP--------AHNNVEPPEQRLFP 463
            |:|........|.:   ..|.|:.:|:.|.    .|...:|..        :.::.:..|.:..|
Mouse   277 SRTTNVASVFPERISAHSSDFSWAELQRLN----AGTWFLERQPFWGAKKLSGSDRKEAENQTIP 337

  Fly   464 TLQDFFER---VNLSTGFDIEIKWPQQRADGLFES--EQTLDKNLFADRILAVV 512
            .|::..:.   :|||..||:. :.|:...  .:::  .|||:..|.|:...|:|
Mouse   338 ALEELLKEAAALNLSIMFDLR-RPPRNHT--YYDTFVNQTLEAVLSANVSQAMV 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9394NP_611548.1 CBM20 47..169 CDD:449530
GDPD_GDE5 345..630 CDD:176549 46/184 (25%)
Gdpd2NP_076097.1 PI-PLCc_GDPD_SF 198..500 CDD:472694 46/184 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.