DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9394 and Gde1

DIOPT Version :10

Sequence 1:NP_611548.1 Gene:CG9394 / 37399 FlyBaseID:FBgn0034588 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_062526.1 Gene:Gde1 / 56209 MGIID:1891827 Length:331 Species:Mus musculus


Alignment Length:141 Identity:44/141 - (31%)
Similarity:71/141 - (50%) Gaps:38/141 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   347 IGHRGLGKSLTVTTNAAPLIENTVATMLASSELGADLVEFDVQLTSDLVPIIHHDFSIRVCIDSK 411
            |.|||       .::.||  |||:|.:..:::.||..||.|::.|||.||::.||.:    :|..
Mouse    68 IAHRG-------GSHDAP--ENTLAAIRQAAKNGATGVELDIEFTSDGVPVLMHDNT----VDRT 119

  Fly   412 TPTSKDDLTEVLLKDISYEQLKDLKTYQIVGNKIVEYPAHNN---VEPPEQRLFPTLQDFFE--- 470
            |..|.      .|.|:::||::.|.            ||.|:   .|.|::|: |||::...   
Mouse   120 TDGSG------RLCDLTFEQVRKLN------------PAANHRLRNEFPDERI-PTLKEAVTECL 165

  Fly   471 RVNLSTGFDIE 481
            |.||:..||::
Mouse   166 RHNLTIFFDVK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9394NP_611548.1 CBM20 47..169 CDD:449530
GDPD_GDE5 345..630 CDD:176549 44/141 (31%)
Gde1NP_062526.1 GDPD_GDE1 68..323 CDD:176515 44/141 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.