DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9394 and pgc1

DIOPT Version :10

Sequence 1:NP_611548.1 Gene:CG9394 / 37399 FlyBaseID:FBgn0034588 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_594955.2 Gene:pgc1 / 2543587 PomBaseID:SPAC4D7.02C Length:311 Species:Schizosaccharomyces pombe


Alignment Length:149 Identity:40/149 - (26%)
Similarity:61/149 - (40%) Gaps:34/149 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 LEIGHRGLGKSLTVTTNAAPLIENTVATMLASSELGADLVEFDVQLTSDLVPIIHHDFSIRVCID 409
            |.|.|||.         .|...|||:.....:.:.|||.||.||:||.|.|..|.||.::.....
pombe    33 LVIAHRGY---------KAKYPENTILAFQQAVKAGADCVETDVRLTKDEVVCILHDRNLNRVFG 88

  Fly   410 SKTPTSKDDLTEVLLKDISY-----------EQLKDLKTYQIVGNKIVEYPAHN---NVEPPEQR 460
                      .:|.::|:.|           |..:.|.||:...:::.::|..|   :::|....
pombe    89 ----------VDVDVRDLDYELDNGHFRTIQEPHEPLPTYEQFLHELTKHPGVNLLVDIKPVNDL 143

  Fly   461 L-FPTLQDFFERVNLSTGF 478
            | .|.:.|...|||....|
pombe   144 LIIPRMVDAMLRVNSDLDF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9394NP_611548.1 CBM20 47..169 CDD:449530
GDPD_GDE5 345..630 CDD:176549 40/149 (27%)
pgc1NP_594955.2 GDPD_YPL206cp_fungi 34..265 CDD:176512 39/148 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.