DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9394 and T09B9.3

DIOPT Version :10

Sequence 1:NP_611548.1 Gene:CG9394 / 37399 FlyBaseID:FBgn0034588 Length:679 Species:Drosophila melanogaster
Sequence 2:NP_509638.2 Gene:T09B9.3 / 188321 WormBaseID:WBGene00011644 Length:340 Species:Caenorhabditis elegans


Alignment Length:121 Identity:24/121 - (19%)
Similarity:41/121 - (33%) Gaps:46/121 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 ENTVATMLASSELGADLVEFDVQLTSD-----LVP------------------------------ 396
            :||:.....:.:.|||.:..||::|.|     |:|                              
 Worm    80 KNTIPAFRQAKQNGADTIVMDVRMTKDGMLIVLLPDSVDTDNATYIVDETHWIQMSQLNVYGGNN 144

  Fly   397 --IIHHDFSIRVCIDSK------TPTSKDDLTEVLLKDISYEQLKD---LKTYQIV 441
              |:..|.::..|..:|      .|:...||...|...|..:.|.|   :.||.::
 Worm   145 GTILTFDEAVSWCEANKMNMIWHIPSFSSDLLTYLRNKIMQDSLYDKVAVTTYNLI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9394NP_611548.1 CBM20 47..169 CDD:449530
GDPD_GDE5 345..630 CDD:176549 24/121 (20%)
T09B9.3NP_509638.2 GDPD_GDE1 67..314 CDD:176515 24/121 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.