DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and KCNK6

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_004814.1 Gene:KCNK6 / 9424 HGNCID:6281 Length:313 Species:Homo sapiens


Alignment Length:404 Identity:87/404 - (21%)
Similarity:144/404 - (35%) Gaps:135/404 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 LICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQKLRSFE 594
            |...|..|..|.||....||..|...:.|:..::...:.|.            ..:|...|.:|.
Human    11 LAAYAAYLVLGALLVARLEGPHEARLRAELETLRAQLLQRS------------PCVAAPALDAFV 63

  Fly   595 DELNNLAELG---LRRYPG-----QKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAI 651
            :.:.....||   |....|     ..:|:|.:...|..|:|||:|||:.||.|..|::.:|.:|:
Human    64 ERVLAAGRLGRVVLANASGSANASDPAWDFASALFFASTLITTVGYGYTTPLTDAGKAFSIAFAL 128

  Fly   652 IGIPMFLIVLA----DLGKLFTRCVKFLWVYVRRMYYTR--SCRRIRKQQQIRSAMTGFNTMYDM 710
            :|:|..:::|.    .|..|.|. |...|:.:|..:..|  :|..:                   
Human   129 LGVPTTMLLLTASAQRLSLLLTH-VPLSWLSMRWGWDPRRAACWHL------------------- 173

  Fly   711 AIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLIT 775
                                                                   |::..:::..
Human   174 -------------------------------------------------------VALLGVVVTV 183

  Fly   776 YILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLV----PSNPF---YVMVSMIYLMFGLAL 833
            ..|:.:..|..:|.:|:.|||||:.|||:||||.||.|    |..|:   |.::..:||..||  
Human   184 CFLVPAVIFAHLEEAWSFLDAFYFCFISLSTIGLGDYVPGEAPGQPYRALYKVLVTVYLFLGL-- 246

  Fly   834 TSMFINVVQIKLSDHFKMASAKVGATIGMNMTSELGDEGGSQVKTPSELASVHGSRLDRIE---- 894
                  |..:.:...|:..|...|.|       ||      .:..|...||.:....||::    
Human   247 ------VAMVLVLQTFRHVSDLHGLT-------EL------ILLPPPCPASFNADEDDRVDILGP 292

  Fly   895 --EDGQEANGNGHS 906
              |..|:.:.:.|:
Human   293 QPESHQQLSASSHT 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 21/59 (36%)
Ion_trans_2 771..847 CDD:285168 27/82 (33%)
KCNK6NP_004814.1 Ion_trans_2 <91..146 CDD:285168 19/54 (35%)
Ion_trans_2 180..256 CDD:285168 27/83 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 288..313 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.