DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and KCNK17

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_113648.2 Gene:KCNK17 / 89822 HGNCID:14465 Length:332 Species:Homo sapiens


Alignment Length:437 Identity:100/437 - (22%)
Similarity:163/437 - (37%) Gaps:157/437 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 IAYLICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREED---WKSLARQ 588
            :|||..:|  ||.|  :|...||.|       .:...|.|....|::..|....|   ..||.|.
Human    27 LAYLAYLA--LGTG--VFWTLEGRA-------AQDSSRSFQRDKWELLQNFTCLDRPALDSLIRD 80

  Fly   589 KLRSFEDE---LNNLAELGLRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYA 650
            .::::::.   |:|...:|        .|..|..|.|..:.|||||||:::|.|...|...|.:|
Human    81 VVQAYKNGASLLSNTTSMG--------RWELVGSFFFSVSTITTIGYGNLSPNTMAARLFCIFFA 137

  Fly   651 IIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRP 715
            ::|||:.|:||..||.|..:.|.. |                                       
Human   138 LVGIPLNLVVLNRLGHLMQQGVNH-W--------------------------------------- 162

  Fly   716 SMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLL--LITYIL 778
                                |:|..|             |::..|:........:||  |:.::|
Human   163 --------------------ASRLGG-------------TWQDPDKARWLAGSGALLSGLLLFLL 194

  Fly   779 LGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGD-LVPSNP------FYVMVSMIYLMFGLALTSM 836
            |....|..|| .|:..:.||:.||::||:|||| ::..||      :|..:..::::||:|..::
Human   195 LPPLLFSHME-GWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLWYKNMVSLWILFGMAWLAL 258

  Fly   837 FINVVQIKLSDHFKMASAKVGATIGMNMTSELGDEGGSQVKTPSELASV--HGSRLD---RIEED 896
            .|.::.                               ||::||..:.|.  |.|:.|   :....
Human   259 IIKLIL-------------------------------SQLETPGRVCSCCHHSSKEDFKSQSWRQ 292

  Fly   897 GQEANGNGHSPVP------PLTSILRAPRPLSPASNGVDANGVGADA 937
            |.:.....|||..      |:..|    :.|.|:::   |.|.|.|:
Human   293 GPDREPESHSPQQGCYPEGPMGII----QHLEPSAH---AAGCGKDS 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 25/55 (45%)
Ion_trans_2 771..847 CDD:285168 26/84 (31%)
KCNK17NP_113648.2 Ion_trans_2 96..157 CDD:285168 26/68 (38%)
Ion_trans_2 <203..268 CDD:285168 22/96 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..312 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155180
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.