DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and TOK1

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_012442.1 Gene:TOK1 / 853352 SGDID:S000003629 Length:691 Species:Saccharomyces cerevisiae


Alignment Length:391 Identity:75/391 - (19%)
Similarity:132/391 - (33%) Gaps:123/391 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 GLRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLF 668
            |...:.|.....:.|...||...:.|:|.|.|.||:...:.:.:::::.|:.:..::        
Yeast   262 GAGMFSGLLHITYGNALYFCTVSLLTVGLGDILPKSVGAKIMVLIFSLSGVVLMGLI-------- 318

  Fly   669 TRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQAD 733
                         ::.|||.  |:|..                  .|..||..            
Yeast   319 -------------VFMTRSI--IQKSS------------------GPIFFFHR------------ 338

  Fly   734 AEAARSVGTSH--PETPTSPYPETFEV-----------DDEFNLPVSVASLLLITYILLGSFGFL 785
            .|..||....|  ..:......|.|::           ...|:|.|::|  :.:.:.|||:..|.
Yeast   339 VEKGRSKSWKHYMDSSKNLSEREAFDLMKCIRQTASRKQHWFSLSVTIA--IFMAFWLLGALVFK 401

  Fly   786 MMEPSWTPLDAFYYVFISMSTIGFGDLVP----SNPFYVMVSMIYLMFGLALTSMFINVVQIKLS 846
            ..| :|:..:..|:.|:.:.|||:||..|    ...|:|    |:.:..:.|....::.|...|.
Yeast   402 FAE-NWSYFNCIYFCFLCLLTIGYGDYAPRTGAGRAFFV----IWALGAVPLMGAILSTVGDLLF 461

  Fly   847 DHFKMASAKVGATIG-----------------MNMTSELGDE-----GGSQVKTPSELASVHGSR 889
            |.......|:|.:..                 |..|.|:.:|     |..:..|.|.    ..|:
Yeast   462 DISTSLDIKIGESFNNKVKSIVFNGRQRALSFMVNTGEIFEESDTADGDLEENTTSS----QSSQ 522

  Fly   890 LDRIEEDGQEANGNGHSPVPPLTSILRAPRPLSPASNGVDANGVGADAVGAGDVTPPPLLPRRQV 954
            :....::..|.|.:|.:..|  .|:..:...||.||                  :|..:||...|
Yeast   523 ISEFNDNNSEENDSGVTSPP--ASLQESFSSLSKAS------------------SPEGILPLEYV 567

  Fly   955 S 955
            |
Yeast   568 S 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 10/55 (18%)
Ion_trans_2 771..847 CDD:285168 20/79 (25%)
TOK1NP_012442.1 Ion_trans_2 253..328 CDD:400301 16/88 (18%)
Ion_trans_2 388..462 CDD:400301 20/78 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345207
Domainoid 1 1.000 56 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.