DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and KCNK16

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001128577.1 Gene:KCNK16 / 83795 HGNCID:14464 Length:322 Species:Homo sapiens


Alignment Length:303 Identity:66/303 - (21%)
Similarity:109/303 - (35%) Gaps:110/303 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 IAYLICMAMLLGFGGLLFRYTEGAAENIYKCEVRKVKRDFIDRLWDVSHNMREEDWKSLARQKLR 591
            :|| :|..:|   |..:|:..|..||...:.:.:..|..|:            |::..|.:..:.
Human    19 LAY-VCYLLL---GATIFQLLERQAEAQSRDQFQLEKLRFL------------ENYTCLDQWAME 67

  Fly   592 SF-----EDELNNLAELGLRRYPGQKSWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAI 651
            .|     |..:..:...|....|  .:|:|.:.|.|..||:||||||::.|.|..|:...:.||:
Human    68 QFVQVIMEAWVKGVNPKGNSTNP--SNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYAL 130

  Fly   652 IGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPS 716
            :|||:.:|.|..||                                    ||.....        
Human   131 LGIPLNVIFLNHLG------------------------------------TGLRAHL-------- 151

  Fly   717 MFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGS 781
                 :|.|..|:....::..:.:|                               |..::.||:
Human   152 -----AAIERWEDRPRRSQVLQVLG-------------------------------LALFLTLGT 180

  Fly   782 FGFLMMEP-------SWTPLDAFYYVFISMSTIGFGDLVPSNP 817
            ...|:..|       .|:..:.||:.||::|||||||.|..:|
Human   181 LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGHP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 24/55 (44%)
Ion_trans_2 771..847 CDD:285168 19/54 (35%)
KCNK16NP_001128577.1 Ion_trans_2 <92..148 CDD:311712 26/91 (29%)
Ion_trans_2 180..>224 CDD:311712 16/44 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000030
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.