DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and KCO2

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_199449.1 Gene:KCO2 / 834680 AraportID:AT5G46370 Length:443 Species:Arabidopsis thaliana


Alignment Length:226 Identity:50/226 - (22%)
Similarity:89/226 - (39%) Gaps:59/226 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   690 RIRKQQQI------------RSAMTGFNTMYD--MAIRRPSMFFSNSAPENDEESQADAEAARSV 740
            |.||:..:            .||.|.|:...|  :.:..|:.....|.|..:......|.|..::
plant    61 RSRKESSLPIDALSQNPSTSSSATTSFSDSTDLLLPLTEPNKPVRKSKPTINFHRSKTAPAMAAI 125

  Fly   741 GT-SHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGSFGFLMMEPSWT------PLDAFY 798
            .. |||..     |:|.:..|...: |:.|..||:.|:.||...:.:...|:.      .:||.|
plant   126 NNISHPND-----PKTDQQSDSKTI-VNQAVALLVVYLSLGVLIYWLNRDSYNVKQTHPVVDALY 184

  Fly   799 YVFISMSTIGFGDLVPSNPFYVMVSMIYLMFG-----LALTSMFINVVQIK-------------- 844
            :..::|.|||:||:.|.:....:.|:.:::.|     :.|:.|...|:.::              
plant   185 FCIVTMCTIGYGDITPDSVVTKLFSIFFVLVGFGFMDILLSGMVTYVLDLQENYMLETARNESLN 249

  Fly   845 LSDHFKMAS-------------AKVGATIGM 862
            |:|..|:.|             .|||..:|:
plant   250 LNDRDKVRSYIIDVKKGRMRIRLKVGLALGV 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168
Ion_trans_2 771..847 CDD:285168 22/100 (22%)
KCO2NP_199449.1 Ion_trans_2 152..233 CDD:400301 21/80 (26%)
Ion_trans_2 280..350 CDD:400301 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.