DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and KCO5

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_192093.1 Gene:KCO5 / 828091 AraportID:AT4G01840 Length:408 Species:Arabidopsis thaliana


Alignment Length:136 Identity:32/136 - (23%)
Similarity:63/136 - (46%) Gaps:20/136 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   725 ENDEESQADAEAARSVGTSHP--ETPTSPY-----------PETFEVDDEFNLPVSVASLLLITY 776
            :.|::|.:| |..|.:..:.|  .:.|:|.           |||.:........:..|..|||.|
plant    64 KEDQDSDSD-ETNRFLSQTRPLHRSRTAPAMVIIKDLRTKPPETKKPSPVSKSIIRQAIFLLIVY 127

  Fly   777 ILLGSFGFLMMEPSWTPL------DAFYYVFISMSTIGFGDLVPSNPFYVMVSMIYLMFGLALTS 835
            :.||...:......::.:      ||.|:..::|.|||:||:.|..|:..:.::::::||.....
plant   128 LTLGVSIYSFNRDHYSGIETHPVVDALYFCIVTMCTIGYGDIAPLTPWTKIFAVVFVLFGFGFLD 192

  Fly   836 MFINVV 841
            :.::.|
plant   193 ILLSGV 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168
Ion_trans_2 771..847 CDD:285168 20/77 (26%)
KCO5NP_192093.1 Ion_trans_2 122..204 CDD:285168 20/77 (26%)
Ion_trans_2 254..325 CDD:285168
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.