DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and KCO6

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_193550.1 Gene:KCO6 / 827541 AraportID:AT4G18160 Length:436 Species:Arabidopsis thaliana


Alignment Length:299 Identity:64/299 - (21%)
Similarity:117/299 - (39%) Gaps:80/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   572 DVSHNMREEDWKSLARQKLRSFEDELNNLAELG-----LRR--YPGQKSWNFVNCFIFCWTVITT 629
            |:.|.:|::|....:|..:|.....|.....||     |.|  |...::...|:...||...:.|
plant   132 DLHHPIRQKDPTETSRSVVRQAFALLVVYLSLGVLIYWLNRDHYVVNQTHPVVDGLYFCIVTMCT 196

  Fly   630 IGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQ 694
            ||||.|||.:.:.:..:|::.::|.....|:|:.:       |.:: :.::..|           
plant   197 IGYGDITPNSVVTKLFSIMFVLVGFGFIDILLSGM-------VSYV-LDLQESY----------- 242

  Fly   695 QQIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVD 759
                        |.|.|.||       ..||.......|.:..|.                    
plant   243 ------------MLDSAKRR-------DEPEKRRSYIIDVKKGRM-------------------- 268

  Fly   760 DEFNLPVSVASLLLITYILLGSFGFL--MMEPSWTPLDAFYYVFISMSTIGFGD----LVPSNPF 818
             ...|.|::|..:::..|.:| .|.:  :.|..|  ||:||...:|::|:|:||    .:|...|
plant   269 -RIRLKVALALGVVVLCIAVG-VGIMHFIEEIGW--LDSFYLSVMSVTTVGYGDRAFKTLPGRLF 329

  Fly   819 YVMVSMIYLMFG-LALTSMFINVVQIKLSDHFKMASAKV 856
                :.|:|:.. ||:...|:.:.:.::....:..:.||
plant   330 ----AAIWLLVSTLAVARAFLYLAEARVDKRNRERAKKV 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 15/55 (27%)
Ion_trans_2 771..847 CDD:285168 21/82 (26%)
KCO6NP_193550.1 Ion_trans_2 156..237 CDD:400301 22/88 (25%)
Ion_trans_2 280..351 CDD:400301 21/77 (27%)
EF-hand_7 374..431 CDD:404394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D774951at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11003
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.