DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34396 and CG42340

DIOPT Version :9

Sequence 1:NP_611547.2 Gene:CG34396 / 37398 FlyBaseID:FBgn0085425 Length:975 Species:Drosophila melanogaster
Sequence 2:NP_001368973.1 Gene:CG42340 / 7354472 FlyBaseID:FBgn0259242 Length:759 Species:Drosophila melanogaster


Alignment Length:594 Identity:123/594 - (20%)
Similarity:225/594 - (37%) Gaps:182/594 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 RNRCIA---YLICMAMLLGFGGLLFRYTEGAAEN------------------IYKCEVRKVKRDF 566
            ::.||:   .|:.:.:....|.::|...||..|:                  :...|:|.   ..
  Fly    90 KSHCISATGVLLLVLLYTAMGSIVFVTLEGELEDGGALETAVAASKPYPRTELANAEIRS---RT 151

  Fly   567 IDRLWDVSHNMR---EEDWKSLARQKLRSFEDELNNLAELGLRRYPG-------QKSWNFVNCFI 621
            :||||.::.::.   :|:|..||.|:::.|:|.|...........||       ...|.:.:.|:
  Fly   152 VDRLWSITEDLNILYKENWTRLAAQEVQLFQDTLLRAVRQSKVYPPGGIQLNAPTHKWTYASAFL 216

  Fly   622 FCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTR 686
            :..|:|||||||.|:|:|..||...:|||:.|||:.|:.|:.:|:..:..::.|:   ||     
  Fly   217 YSLTLITTIGYGGISPRTQWGRVAALVYALFGIPIVLLYLSAMGEALSAGMRCLF---RR----- 273

  Fly   687 SCRRI--------------------------RKQQQIR-SAMTGFNTMYDMAIRRPSMFFSNSAP 724
              :|:                          ||..:.: ....|...::...: .||::....|.
  Fly   274 --QRVKGGPGGGPGGGASGGVGSGAGGSGGGRKTDKNKGQGHYGHQKLHQYGL-PPSVYQQQQAQ 335

  Fly   725 ENDEESQADAEAARSV--------GTSHPETPTSPYPETFEVDDEFNLPVSVASLLLITYILLGS 781
            :..:..|..|:.|:..        ..|......||           ::|:|:...:|:.|:..|:
  Fly   336 QAQQAQQQQAQQAQQAQQQQVQQGKKSSGNRRGSP-----------SVPISICVCVLLCYVSSGA 389

  Fly   782 FGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSNPFYVMVSMIYLMFGLALTSMFINVVQIKL- 845
            ..|..:: :|:.|::.|:.|.|:.|||||::.|:....:..:..|::.|:|:.:|..:::|.:: 
  Fly   390 ILFHKLQ-NWSVLESLYFCFTSLGTIGFGEMAPNGAVALYTASAYILVGMAVVAMCFSLIQTEIV 453

  Fly   846 --------SDHFKMASAKVGATIGMNMTSE-----------------LGDEGGS---------QV 876
                    .||. |..|:..|.:.:.:|.:                 :|..||:         |.
  Fly   454 LWLRRFSVQDHV-MPKAEELALVTVAVTPKPSXQRPSADPSLGVGLGVGLAGGALGQPQNNLGQH 517

  Fly   877 KT----PSELASVHGSRLDRIEEDGQEANGNG-----HSPVPPLTSI------------------ 914
            :|    |:...:.:.|...|........:|.|     ::|:...|.|                  
  Fly   518 QTMFFGPAHTLTQYSSLPRRSHLQAANNSGGGSAFQRNTPIRRSTGIPEHHLEYFVPRSISEFNL 582

  Fly   915 -------LRAPRPLSP--ASNGVDANGVGADAVGAG-------------DVTPPPLL-----PRR 952
                   |..||..||  ...|....|:|.:..|.|             .:.||..|     |..
  Fly   583 SGVGDLALPPPRRYSPNMVGGGGGMGGMGMNMGGMGMNMGMGMGLPHGLQLGPPQTLLCSAAPTV 647

  Fly   953 QVSVDPQPP 961
            |....|.||
  Fly   648 QQQQQPPPP 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34396NP_611547.2 RILP-like 135..>217 CDD:304877
Ion_trans_2 <614..670 CDD:285168 24/55 (44%)
Ion_trans_2 771..847 CDD:285168 20/84 (24%)
CG42340NP_001368973.1 Ion_trans_2 <208..264 CDD:400301 24/55 (44%)
Ion_trans_2 380..453 CDD:400301 20/73 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45461313
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1418
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D542195at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11003
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.